Engineered 23S rRNAs and methods of use thereof for translation of proteins incorporating non-standard amino acids are provided. Typically, the 23S rRNA includes one or more mutations at positions 2496-2507 relative to E. coli wildtype 23S rRNA, wherein a ribosome composed of the 23S rRNA can catalyze the covalent transfer of a non-standard amino acid from an aminoacyl-RNA onto a nascent peptide chain. For example, the 23S rRNA can include the sequence UGACUU at positions 2502-2507 relative to E. coli wildtype 23S rRNA, and optionally the sequence AGCGUGA from positions 2057-2063 relative to E. coli wildtype 23S rRNA. The 23S rRNA can include additional or alternative deletions, substitutions, insertions, or combination thereof. The compositions and methods can be used to make polypeptides and sequence defined polymers.
1. A 23S rRNA comprising one or more mutations at positions 2496-2507 relative to 2. The 23S rRNA of 3. The 23S rRNA of 4. The 23S rRNA of 5. The 23S rRNA of 6. The 23S rRNA 7. A 23S rRNA comprising a peptidyl transferase center, wherein the peptidyl transferase center is a variant of 8. A 23S rRNA comprising a domain V, wherein the domain V is a variant of 9. The 23S rRNA of 10. The 23S rRNA of 11. A ribosome comprising the 23S rRNA of 12. A polynucleotide encoding the 23S rRNA of 13. A vector comprising the polynucleotide of 14. A host cell comprising the 23S rRNA of 15. (canceled) 16. A host cell comprising the polynucleotide of 17. A host cell comprising the vector of 18.-20. (canceled) 21. The host cell of 22. (canceled) 23. A method for site specific incorporation of a non-standard amino acid into a target protein, comprising expressing a messenger RNA (mRNA) encoding the target protein in a system comprising:
canonical amino acids, at least one non-standard amino acid, ribosomes, aminoacyl tRNA synthetases, tRNAs, and EF-Tu, wherein the ribosomes comprise the 23S rRNA of at least one tRNA that can be aminoacylated with the non-standard amino acid to form an aminoacylated-tRNA that recognizes at least one codon in the mRNA encoding the target protein; an elongation factor (EF-TU) that binds the aminoacylated-tRNA aminoacylated with the non-standard amino acid; and wherein the aminoacylated-tRNA with the non-standard amino acid recognizes at least one codon such that non-standard amino acid is incorporated into a protein or polypeptide during translation. 24.-32. (canceled) 33. A polypeptide comprising one or more iterations of one or more non-standard amino acids prepared according to the method of 34. A sequence defined polymer comprising one or more iterations of one or more non-standard amino acids prepared according to the method of 35. (canceled)
This application claims benefit of and priority to U.S. Provisional Application No. 62/309,853, filed Mar. 17, 2016, which is hereby incorporated herein by reference in its entirety This invention was made with government support under 1122492 awarded by National Science Foundation. The government has certain rights in the invention. The Sequence Listing submitted as a text file named “YU_6929_PCT_ST25.txt,” created on Mar. 17, 2017, and having a size of 21,036 bytes is hereby incorporated by reference pursuant to 37 C.F.R. § 1.52(e)(5). The field of the present invention generally relates to compositions and methods for incorporation of non-standard amino acids into proteins and peptides and other oligomers during translation. Template-guided polymerization is the chemical foundation of the central dogma. It facilitates the evolution of natural biopolymers for greater fitness, and, when co-opted for engineering, can optimize biopolymer sequence to define structure and promote function (Lutz, et al., It was recently reported that ribosomes from certain erythromycin-resistant Protein therapeutics represent the majority of new drug applications, as well as more than one third of FDA-approved drugs in 2014. This trend is likely to continue as researchers increasingly learn to leverage the strengths of protein drugs, including their evolvability, specificity, target-binding affinity, ability to disrupt protein-protein interfaces, and ability to catalyze chemical reactions. Extending the physiological lifetime and reducing the immunogenicity of protein therapeutics by selective β-amino acid incorporation will improve human therapeutics. Such an impact would transform human medicine and has the potential to create a new biotechnological sub-economy as well as corresponding educational opportunities. Therefore, it is an object of the invention to provide compositions and methods of preparation of polypeptides having one or more non-standard amino acids, particularly, one or more β3-amino acids, in vivo. It is a further object of the invention to provide 23S rRNA and ribosomes thereof with an improved ribosomal peptidyl transferase activity for β3-amino acids. Engineered 23S rRNAs and methods of use thereof for translation of proteins incorporating non-standard amino acids are provided. Typically, the 23S rRNA includes one or more mutations at positions 2496-2507 relative to In particular embodiments, an engineered 23S rRNA includes a peptidyl transferase center, wherein the peptidyl transferase center is a variant of Ribosomes including the engineered 23S rRNA and polynucleotides encoding the 23S rRNA are also provided. The polynucleotide can be operatively linked to an expression control sequence. The polynucleotide can be introduced in a host cell and expressed extrachromosomally (e.g., from an expression vector such as a plasmid), or integrated or incorporated in the host's genome. The host cell is a prokaryote or a eukaryote. In preferred embodiments, the host cell is a prokaryote, for example, a bacterium, such as Methods of making polypeptides incorporating one or more non-standard amino acids, and polypeptides made therefrom are also provided. For example, a method for site specific incorporation of a non-standard amino acid into a target protein can include expressing a messenger RNA (mRNA) encoding the target protein in a system including: canonical amino acids, at least one non-standard amino acid, ribosomes, aminoacyl tRNA synthetases, tRNAs, and EF-Tu, preferably wherein the ribosomes include the disclosed 23S rRNA; at least one aminoacyl tRNA synthetase (AARS) that can aminoacylate a tRNA (or a tRNA surrogate) with the non-standard amino acid; at least one tRNA (or surrogate) that can be aminoacylated with the non-standard amino acid to form an aminoacylated-tRNA that recognizes at least one codon in the mRNA encoding the target protein; and an elongation factor (EF-TU) that binds the aminoacylated-tRNA aminoacylated with the non-standard amino acid; wherein the aminoacylated-tRNA with the non-standard amino acid recognizes at least one codon such that non-standard amino acid is incorporated into a protein or polypeptide during translation. The non-standard amino acid can be a non-α amino acid, for example a β amino acid such as a β3-amino acid. The AARS that aminoacylates a tRNA with the non-standard amino acid can be, for example, wildtype The incorporation of the non-standard amino acid into a target protein can occur in vivo in a host cell, or in vitro in, for example, a cell-free translation system. The host cell can be a prokaryote, for example a bacterium such as The compositions and methods can be used to make polypeptide and sequence defined polymers having one or more iterations of one of more non-standard amino acids. Exemplary polymers include sequence-defined polyolefins, aramids, polyurethanes, and polycarbonates. As used herein, the terms “transfer RNA” and “tRNA” refers to a set of genetically encoded RNAs that act during protein synthesis as adaptor molecules, matching individual amino acids to their corresponding codon on a messenger RNA (mRNA). In higher eukaryotes such as mammals, there is at least one tRNA for each of the 20 naturally occurring amino acids. In eukaryotes, including mammals, tRNAs are encoded by families of genes that are 73 to 150 base pairs long. tRNAs assume a secondary structure with four base paired stems known as the cloverleaf structure. The tRNA contains a stem and an anticodon. The anticodon is complementary to the codon specifying the tRNA's corresponding amino acid. The anticodon is in the loop that is opposite of the stem containing the terminal nucleotides. The 3′ end of a tRNA is aminoacylated by a tRNA synthetase so that an amino acid is attached to the 3′end of the tRNA. This amino acid is delivered to a growing polypeptide chain as the anticodon sequence of the tRNA reads a codon triplet in an mRNA. As used herein, the term “anticodon” refers to a unit made up of typically three nucleotides that correspond to the three bases of a codon on the mRNA. Each tRNA contains a specific anticodon triplet sequence that can base-pair to one or more codons for an amino acid or “stop codon.” Known “stop codons” include, but are not limited to, the three codon bases, UAA known as ochre, UAG known as amber and UGA known as opal, which do not code for an amino acid but act as signals for the termination of protein synthesis. tRNAs do not decode stop codons naturally, but can and have been engineered to do so. Stop codons are usually recognized by enzymes (release factors) that cleave the polypeptide as opposed to encode an amino acid via a tRNA. As used herein, the term “suppressor tRNA” refers to a tRNA that alters the reading of a messenger RNA (mRNA) in a given translation system. For example, a non-sense suppressor tRNA can read through a stop codon. As used herein, the term “aminoacyl tRNA synthetase (AARS)” refers to an enzyme that catalyzes the esterification of a specific amino acid or its precursor to one of all its compatible cognate tRNAs to form an aminoacyl-tRNA. These charged aminoacyl tRNAs then participate in mRNA translation and protein synthesis. The AARS show high specificity for charging a specific tRNA with the appropriate amino acid. In general, there is at least one AARS for each of the twenty amino acids. As used herein, the term “residue” refers to an amino acid that is incorporated into a protein. The amino acid may be a naturally occurring amino acid and, unless otherwise limited, may encompass known analogs of natural amino acids that can function in a similar manner as naturally occurring amino acids. As used herein, the terms “polynucleotide” and “nucleic acid sequence” refers to a natural or synthetic molecule including two or more nucleotides linked by a phosphate group at the 3′ position of one nucleotide to the 5′ end of another nucleotide. The polynucleotide is not limited by length and can include deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). As used herein, the term “vector” refers to a polynucleotide capable of transporting into a cell another polynucleotide to which the vector sequence has been linked. “Vector” can refer to a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. The vectors can be expression vectors. “Plasmid” and “vector” are used interchangeably, as a plasmid is a commonly used form of vector. As used herein, the term “expression vector” includes any vector, (e.g., a plasmid, cosmid or phage chromosome) containing a gene construct in a form suitable for expression by a cell (e.g., linked to a transcriptional control element). Thus an expression vector can include one or more expression control sequences. As used herein, the term “expression control sequence” refers to a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence. Control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, a ribosome binding site, and the like. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers. As used herein, the term “promoter” refers to a regulatory nucleic acid sequence, typically located upstream (5′) of a gene or protein coding sequence that, in conjunction with various elements, is responsible for regulating the expression of the gene or protein coding sequence. These include constitutive promoters, inducible promoters, tissue- and cell-specific promoters and developmentally-regulated promoters. As used herein, the term “operatively linked to” refers to the functional relationship of a nucleic acid with another nucleic acid sequence, or to a protein sequence with another protein sequence. Promoters, enhancers, transcriptional and translational stop sites, and other signal sequences are examples of nucleic acid sequences operatively linked to other sequences. For example, operative linkage of gene to a transcriptional control element refers to the physical and functional relationship between the gene and promoter such that the transcription of the gene is initiated from the promoter by an RNA polymerase that specifically recognizes, binds to and transcribes the DNA. As used herein, the terms “transformation” and “transfection” refer to the introduction of a polynucleotide, e.g., an expression vector, into a recipient cell including introduction of a polynucleotide to the chromosomal DNA of the cell. As used herein, the term “conservative variant” refers to a particular nucleic acid sequence that encodes identical or essentially identical amino acid sequences. Conservative substitution tables providing functionally similar amino acids are well known in the art. The following sets forth exemplary groups which contain natural amino acids that are “conservative substitutions” for one another. Conservative Substitution Groups 1 Alanine (A) Serine (S) Threonine (T); 2 Aspartic acid (D) Glutamic acid (E); 3 Asparagine (N) Glutamine (Q); 4 Arginine (R) Lysine (K); 5 Isoleucine (I) Leucine (L) Methionine (M) Valine (V); and 6 Phenylalanine (F) Tyrosine (Y) Tryptophan (W). As used herein, the term “percent (%) sequence identity” or “homology” refers to the percentage of nucleotides or amino acids in a candidate sequence that are identical with the nucleotides or amino acids in a reference nucleic acid sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods. As used herein, the term “transgenic organism” refers to any organism, in which one or more of the cells of the organism contains heterologous nucleic acid introduced by way of human intervention, such as by transgenic techniques well known in the art. The nucleic acid is introduced into the cell, directly or indirectly by introduction into a precursor of the cell, by way of deliberate genetic manipulation, such as by microinjection or by infection with a recombinant virus. Suitable transgenic organisms include, but are not limited to, bacteria, cyanobacteria, fungi, plants and animals. The nucleic acids described herein can be introduced into the host by methods known in the art, for example infection, transfection, transformation or transconjugation. As used herein, the term “eukaryote” or “eukaryotic” refers to organisms or cells or tissues derived from these organisms belonging to the phylogenetic domain Eukarya such as animals (e.g., mammals, insects, reptiles, and birds), ciliates, plants (e.g., monocots, dicots, and algae), fungi, yeasts, flagellates, microsporidia, and protists. As used herein, the term “prokaryote” or “prokaryotic” refers to organisms including, but not limited to, organisms of the Eubacteria phylogenetic domain, such as As used herein, the term “construct” refers to a recombinant genetic molecule having one or more isolated polynucleotide sequences. Genetic constructs used for transgene expression in a host organism include in the 5′-3′ direction, a promoter sequence; a sequence encoding a gene of interest; and a termination sequence. The construct may also include selectable marker gene(s) and other regulatory elements for expression. As used herein, the term “gene” refers to a DNA sequence that encodes through its template or messenger RNA a sequence of amino acids characteristic of a specific peptide, polypeptide, or protein. The term “gene” also refers to a DNA sequence that encodes an RNA product, for example a functional RNA that does not encode a protein or polypeptide (e.g., miRNA, tRNA, etc.). The term gene as used herein with reference to genomic DNA includes intervening, non-coding regions as well as regulatory regions and can include 5′ and 3′untranslated ends. As used herein, the term “isolated” is meant to describe a compound of interest (e.g., nucleic acids) that is in an environment different from that in which the compound naturally occurs, e.g., separated from its natural milieu such as by concentrating a peptide to a concentration at which it is not found in nature. “Isolated” is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified. Isolated nucleic acids are at least 60% free, preferably 75% free, and most preferably 90% free from other associated components. The term “isolated” as used herein with respect to nucleic acids also includes the combination with any non-naturally-occurring nucleic acid sequence, since such non-naturally-occurring sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome. As used herein, the term “purified” and like terms relate to the isolation of a molecule or compound in a form that is substantially free (at least 60% free, preferably 75% free, and most preferably 90% free) from other components normally associated with the molecule or compound in a native environment. As used herein, the term “pharmaceutically acceptable carrier” encompasses any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water and emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents. As used herein, the term “translation system” refers to the components necessary to incorporate an amino acid into a growing polypeptide chain (protein). Key components of a translation system generally include amino acids, ribosomes, tRNAs, AARS, EF-Tu, and mRNA. The components described herein can be added to a translation system, in vivo or in vitro, to incorporate amino acids into a protein. As used herein, the term “orthogonal translation system (OTS)” refers to at least an AARS and paired tRNA that are both heterologous to a host or translational system in which they can participate in translation of an mRNA including at least one codon that can hybridize to the anticodon of the tRNA. As used herein, the terms “recoded organism” and “genomically recoded organism (GRO)” in the context of codons refer to an organism in which the genetic code of the organism has been altered such that a codon has been eliminated from the genetic code by reassignment to a synonymous or non-synonymous codon. As used herein, “genetically modified organism (GMO)” refers to any organism whose genetic material has been modified (e.g., altered, supplemented, etc.) using genetic engineering techniques. The modification can be extrachromasomal (e.g., an episome, plasmid, etc.), by insertion or modification of the organism's genome, or a combination thereof. As used herein, the term “polyspecific” refers to an AARS that can accept and incorporate two or more different amino acids. As used herein, the terms “protein,” “polypeptide,” and “peptide” refers to a natural or synthetic molecule having two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another. The term polypeptide includes proteins and fragments thereof. The polypeptides can be “exogenous,” meaning that they are “heterologous,” i.e., foreign to the host cell being utilized, such as human polypeptide produced by a bacterial cell. Polypeptides are disclosed herein as amino acid residue sequences. Those sequences are written left to right in the direction from the amino to the carboxy terminus. As used herein, “standard amino acid” and “canonical amino acid” refer to the twenty alpha- (α) amino acids that are encoded directly by the codons of the universal genetic code denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gln, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V). As used herein, “non-standard amino acid (nsAA)” refers to any and all amino acids that are not a standard amino acid. Non-standard amino acids include beta- (β-), gamma- (γ-) or delta- (δ-) amino acids, or derivatives of anthranilic acid, or dipeptide units containing any of these variants. nsAA can be created by enzymes through posttranslational modifications; or those that are not found in nature and are entirely synthetic (e.g., synthetic amino acids (sAA)). In both classes, the nsAAs can be made synthetically. As used herein, “040329” refers to a mutant 23S rRNA with 13 base changes relative to wildtype As used herein, “040329 ribosome” refers to a ribosome including 040329 mutant 23S rRNA. Genetically engineered, non-naturally occurring 23S rRNAs, nucleic acids encoding the 23S rRNAs, transfected and genetically modified cells expressing the 23S rRNAs, and ribosomes composed of the 23S rRNAs are provided. Ribosomes including engineered 23S rRNAs have an increased ability to incorporate non-standard, non-natural, non-α-amino acids (NNAs) into protein during in vivo translation or in an in vitro translation system. For example, in some embodiments, the dipeptides, or non-standard-, non-natural-, or non-α-amino acids:α-amino acid incorporation ratio of the disclosed ribosomes, when used in combination with other translation machinery that tolerates incorporation of non-standard, non-natural, or non-α-amino acids, is greater than that of wildtype ribosomes or ribosomes including known 23S mutants such as 040329. Non-standard-, non-natural-, and non-α-amino acids are known in the art. For example, WO 2015/120287 provides a non-exhaustive list of exemplary non-standard and synthetic amino acids that are known in the art (see, e.g., Table 11 of WO 2015/120287). The non-α-amino acid can be a β-amino acid, for example a β2- or β3-amino acid. Two main types of β-peptides exist: those with the organic residue (R) next to the amine are called β3-peptides and those with position next to the carbonyl group are called β2-peptides (see The backbones of β-peptides are longer than those of α-amino acid peptides because β-peptides contain an additional backbone CH2 group (commonly called a methylene group). β-peptides can form many different types of helical structures, and the conformation types can be distinguished by the number of atoms in the hydrogen-bonded ring that is formed in solution; 8-helix, 10-helix, 12-helix, 14-helix, and 10/12-helix have been reported. Generally speaking, β-peptides form a more stable helix than α-peptides and are stable against proteolytic degradation in vitro and in vivo, an important advantage over natural peptides in the preparation of peptide-based drugs (Beke, et al., In particular embodiments, the β3-amino acid is β3-(p-Br)Phe. The β-amino acid/α-amino acid incorporation ratio of ribosomes including the disclosed engineered 23S rRNA is greater than that of wildtype ribosomes or ribosomes including known 23S mutants such as 040329. Thus, in specific embodiments the β3-(p-Br)Phe/α-Phe incorporation ratio is greater than that of wildtype ribosomes or ribosomes including a known 23S mutant such as 040329. An increase in incorporation ratio of the dipeptide, or non-standard-, non-natural-, or non-α-amino acid: α-amino acid can be any integer “n” between 1 and 1,000-fold inclusive, or more than 1,000-fold. In preferred embodiments, the incorporation ratio of the dipeptide, or non-standard-, non-natural-, or non-α-amino acid: α-amino acid by ribosomes including the disclosed 23S rRNA is at least 3-fold greater than ribosomes including 040329 mutant 23S rRNA. A. Engineered 23S rRNA Engineered 23S rRNAs are provided. The engineered rRNAs have one or more mutations at positions 2496-2507 relative to The mutation(s) can be substitutions, insertions, or deletions. Insertions include 5′ and/or 3′ fusions as well as intrasequence insertions of single or multiple nucleotides. Deletions can also be from the 5′ end, the 3′ end, intrasequence deletions, or a combination thereof. In preferred embodiments, any 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides at positions 2496-2507, or more preferably any 1, 2, 3, 4, 5, or 6 nucleotides at positions 2502-2507 are mutated relative to In preferred embodiments, the engineered 23S rRNA includes the sequence UGACUU at positions 2502-2507 in place of GAUGUC (of wildtype). In some embodiments, the engineered 23S rRNA also includes the sequence AGCGUGA from positions 2057-2063. The remaining 23S rRNA sequence can be that of wildtype, or a known variant, including, but not limited to, 040329. In some embodiments, the engineered 23S rRNA includes additional mutations relative to wildtype or a known variant such as 040329. For example, in some embodiments, the engineered 23S rRNA includes UGACUU at positions 2502-2507, optionally includes the sequence AGCGUGA from positions 2057-2063, and has one or more additional mutations relative to The engineered 23S rRNA can include a peptidyl transferase center (PTC) corresponding to the wildtype The engineered 23S rRNA can include a domain V corresponding to the wildtype The 23S rRNA can have, for example, at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity with Various types of mutagenesis can be used to modify a nucleic acid. They include, but are not limited to, site-directed, random point mutagenesis, homologous recombination (DNA shuffling), mutagenesis using uracil containing templates, oligonucleotide-directed mutagenesis, phosphorothioate-modified DNA mutagenesis, and mutagenesis using methods such as gapped duplex DNA. Additional suitable methods include point mismatch repair, mutagenesis using repair-deficient host strains, restriction-selection and restriction-purification, deletion mutagenesis, mutagenesis by total gene synthesis and double-strand break repair. Exemplary methods of introducing diversity randomized using dsDNA fragments (gBlocks) are discussed in the Examples below. The exemplary reference and engineered 23S rRNA sequences are provided as “RNA” sequences, however, in each case the corresponding DNA sequence encoding the rRNA sequence (e.g., wherein the “U” is replaced with a “T”) is also explicitly disclosed. For example, an An alternative The full sequence of mutant 23S rRNA referred to as 040329 is In an exemplary embodiment, the engineered 23S rRNA has the sequence of variant 040329 modified to have the sequence UGACUU at positions 2502-2507 (also referred to herein as “P7A7”). B. Isolated Nucleic Acid Molecules Nucleic acids, including genes, cDNA's, and other sequences encoding engineered 23S rRNA are also disclosed. As used herein, “isolated nucleic acid” refers to a nucleic acid that is separated from other nucleic acid molecules that are present in a genome, including nucleic acids that normally flank one or both sides of the nucleic acid in the genome. An isolated nucleic acid can be, for example, a DNA molecule or an RNA molecule, provided one of the nucleic acid sequences normally found immediately flanking that DNA molecule in a naturally-occurring genome is removed or absent. Thus, an isolated nucleic acid includes, without limitation, a DNA molecule or RNA molecule that exists as a separate molecule independent of other sequences (e.g., a chemically synthesized nucleic acid, or a cDNA, or RNA, or genomic DNA fragment produced by PCR or restriction endonuclease treatment), as well as recombinant DNA that is incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a retrovirus, lentivirus, adenovirus, or herpes virus), or into the genomic DNA of a prokaryote or eukaryote. In addition, an isolated nucleic acid can include an engineered nucleic acid such as a recombinant DNA molecule or RNA molecule that is part of a hybrid or fusion nucleic acid. A nucleic acid existing among hundreds to millions of other nucleic acids within, for example, a cDNA library or a genomic library, or a gel slice containing a genomic DNA restriction digest, is not to be considered an isolated nucleic acid. Nucleic acids can be in sense or antisense orientation, or can be complementary to a reference sequence, for example, a sequence encoding the disclosed rRNAs. Nucleic acids can be DNA, RNA, nucleic acid analogs, or combinations thereof. Nucleic acid analogs can be modified at the base moiety, sugar moiety, or phosphate backbone. Such modification can improve, for example, stability, hybridization, or solubility of the nucleic acid. Modifications at the base moiety can include deoxyuridine for deoxythymidine, and 5-methyl-2′-deoxycytidine or 5-bromo-2′-deoxycytidine for deoxycytidine. Modifications of the sugar moiety can include modification of the 2′ hydroxyl of the ribose sugar to form 2′-O-methyl or 2′-O-allyl sugars. The deoxyribose phosphate backbone can be modified to produce morpholino nucleic acids, in which each base moiety is linked to a six membered, morpholino ring, or peptide nucleic acids, in which the deoxyphosphate backbone is replaced by a pseudopeptide backbone and the four bases are retained. See, for example, Summerton and Weller (1997) Antisense Nucleic Acid Drug Dev. 7:187-195; and Hyrup et al. (1996) Bioorgan. Med. Chem. 4:5-23. In addition, the deoxyphosphate backbone can be replaced with, for example, a phosphorothioate or phosphorodithioate backbone, a phosphoroamidite, or an alkyl phosphotriester backbone. C. Vectors Vectors encoding engineered rRNA are also provided. Nucleic acids, such as those described above, can be inserted into vectors for expression in cells. The vector can be, for example, an expression vector or a cloning vector. Nucleic acids in vectors can be operably linked to one or more expression control sequences. Operably linked means the disclosed sequences are incorporated into a genetic construct so that expression control sequences effectively control expression of a sequence of interest. Examples of expression control sequences include promoters, enhancers, and transcription terminating regions. A promoter is an expression control sequence composed of a region of a DNA molecule, typically within 100 nucleotides upstream of the point at which transcription starts (generally near the initiation site for RNA polymerase II). Although rRNA sequences do not encode a protein, a control sequence can be operably linked to a sequence encoding an rRNA, to control expression of the rRNA in a host cell. See, for example, Ponchon and Dardel, D. Host Cells Host cells including the nucleic acids disclosed herein are also provided. Nucleic acids encoding engineered rRNAs can be transformed or transfected into the host and expressed extrachomasomally, for example by plasmid(s) or another vector(s) or an episome, or the nucleic acids can be integrated into the host's genome. Likewise additional translation machinery can also be transformed or transfected into the host and expressed extrachomasomally or integrated into the host's genome. Exemplary host cells are discussed in more detail below. Expression and translation systems for incorporation of one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids are provided. Suitable dipeptides, non-standard-, non-natural-, and non-α-amino acids are introduced above. Components of a translation system generally include amino acids, ribosomes, tRNAs, mRNA, and synthetases. The translation system can include all twenty canonical amino acids and one or more dipeptides, non-standard-, non-natural-, or non-α-amino acids. In some embodiments, the one or more non-standard-, non-natural-, or non-α-amino acids are substituted for a corresponding or related canonical amino acid. The ribosomes can be wildtype ribosomes and/or preferably include engineered ribosomes such as ribosomes including the disclosed engineered 23S rRNA. tRNAs can be wildtype, engineered, heterologous, or a combination thereof. The system includes at least one tRNA that can be charged with a dipeptide, non-standard-, non-natural-, or non-α-amino acid, as well as tRNAs that can be charged with canonical amino acids. As discussed in more detail below, in some embodiments, a tRNA is polyspecific and can be charged with either a canonical amino acid or a dipeptide, non-standard-, non-natural-, or non-α-amino acids. In some embodiments, the anticodon of such a tRNA is modified to pair with a “stop codon” to form a suppressor tRNA. The suppressor tRNA can modulate incorporation of the dipeptide, non-standard-, non-natural-, or non-α-amino acid at any location of interest within an mRNA encoding a peptide of interest, by designing the mRNA sequence to include a “stop codon” at the desired location. Thus naturally-occurring tRNAs, for example from Additionally, or alternatively, the codon corresponding to the anticodon of a naturally-occurring or wildtype tRNA that can be charged with a dipeptide, non-standard-, non-natural-, or non-α-amino acid can be used to design the mRNA sequence. For example, the experiments below describes that when a DHFR variant containing a single Phe codon at position 128 and a single S to R mutation at position 126 is expressed in The incorporation of one or more non-standard amino acids can be site specific or non-site specific, depending on the selection of the components of the translation system and the sequence of the mRNA of interest. The non-standard amino acid, for example a corresponding non-α amino acid, can simply replace one or more iterations of the corresponding α-amino acid in a polypeptide sequence that is otherwise the same as a naturally-occurring or known peptide sequence. Non-standard amino acids can also be added as one or more additions or insertions to the N-terminus, C-terminus, or within a naturally-occurring or known polypeptide sequence. Aminoacyl-tRNA synthetases (AARS) can be wildtype, engineered, heterologous, or a combination thereof. The system includes at least one AARS that can catalyze the esterification of a dipeptide, non-standard-, non-natural-, or non-α-amino acid or its precursor to a compatible cognate tRNA to form an aminoacyl-tRNA, as well as AARSs that can catalyze the esterification of cognate amino acids or their precursor to compatible cognate tRNAs to form aminoacyl-tRNAs. As discussed in more detail below, in some embodiments, the same AARS has both activities. For example, the Examples show that β3-amino acids are adequate substrates for several wild type In some preferred embodiments, the system includes a PheRS, such as wildtype The disclosed systems and methods can utilize orthogonal AARS-tRNA pairs, including those known in the art. For example, Table 1 and the electronic supplementary information provided in Dumas, et al., The AARS and tRNA can be provided separately, or together, for example, as part of a single construct. In a particular embodiment, the AARS-tRNA pair is evolved from a The disclosed compositions can be added to a translation system, in vivo or in vitro, to incorporate a dipeptide, non-standard-, non-natural-, or non-α-amino acid into a protein. In preferred embodiments, a cell-based (in vivo) expression system is used. In these embodiments, nucleic acids encoding one or more of ribosomes, tRNAs, mRNA, and synthetases are delivered to cells under conditions suitable for translation and/or transcription of ribosomes, tRNAs, mRNA, synthetases or a combination thereof. The cells can in some embodiments be prokaryotic, e.g., an In some embodiments, a cell-free (in vitro) expression system is used. The most frequently used cell-free translation systems involve extracts containing all the macromolecular components (70S or 80S ribosomes, tRNAs, aminoacyl-tRNA synthetases, initiation, elongation and termination factors, etc.) required for translation of exogenous RNA. To ensure efficient translation, each extract is supplemented with amino acids, energy sources (ATP, GTP), energy regenerating systems (creatine phosphate and creatine phosphokinase for eukaryotic systems, and phosphoenol pyruvate and pyruvate kinase for the A. Promoters and Enhancers Nucleic acids that are delivered to cells typically contain expression controlling systems. For example, the inserted genes in viral and retroviral systems usually contain promoters, and/or enhancers to help control the expression of the desired gene product. A promoter is generally a sequence or sequences of DNA that function when in a relatively fixed location in regard to the transcription start site. A promoter contains core elements required for basic interaction of RNA polymerase and transcription factors, and may contain upstream elements and response elements. Therefore, also disclosed is a polynucleotide encoding one or more of wildtype, engineered, or heterologous ribosomal components including the disclosed rRNAs, tRNAs, mRNA, and synthetases operably linked to an expression control sequence. Promoters are typically DNA regulatory regions capable of initiating transcription of a gene of interest. Some promoters are “constitutive,” and direct transcription in the absence of regulatory influences. Some promoters are “tissue specific,” and initiate transcription exclusively or selectively in one or a few tissue types. Some promoters are “inducible,” and achieve gene transcription under the influence of an inducer. Induction can occur, e.g., as the result of a physiologic response, a response to outside signals, or as the result of artificial manipulation. Some promoters respond to the presence of tetracycline; “rtTA” is a reverse tetracycline controlled transactivator. Such promoters are well known to those of skill in the art. The promoter can be an endogenous promoter (e.g., the promoter for wildtype Enhancers provide expression specificity in terms of time, location, and level. Unlike promoters, enhancers can function when located at various distances from the transcription site. An enhancer also can be located downstream from the transcription initiation site. This enhancer generally refers to a sequence of DNA that functions at no fixed distance from the transcription start site and can be either 5′ or 3′ to the transcription unit. Furthermore, enhancers can be within an intron as well as within the coding sequence itself. They are usually between 10 and 300 bp in length, and they function in cis. Enhancers function to increase transcription from nearby promoters. Enhancers also often contain response elements that mediate the regulation of transcription. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, α-fetoprotein and insulin). However, enhancer from a eukaryotic cell virus are preferably used for general expression. Suitable examples include the SV40 enhancer on the late side of the replication origin, the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. A coding sequence is “operably linked” and “under the control” of expression control sequences in a cell when RNA polymerase is able to transcribe the coding sequence into mRNA, which then can be translated into the protein encoded by the coding sequence. In certain embodiments the promoter and/or enhancer region can act as a constitutive promoter and/or enhancer to maximize expression of the region of the transcription unit to be transcribed. In certain constructs the promoter and/or enhancer region is active in all eukaryotic cell types, even if it is only expressed in a particular type of cell at a particular time. A preferred promoter of this type is the CMV promoter. In other embodiments, the promoter and/or enhancer is tissue or cell specific. In certain embodiments the promoter and/or enhancer region is inducible. Induction can occur, e.g., as the result of a physiologic response, a response to outside signals, or as the result of artificial manipulation. Such promoters are well known to those of skill in the art. For example, in some embodiments, the promotor and/or enhancer may be specifically activated either by light or specific chemical events which trigger their function. Systems can be regulated by reagents such as tetracycline and dexamethasone. There are also ways to enhance viral vector gene expression by exposure to irradiation, such as gamma irradiation, or alkylating chemotherapy drugs. Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human or nucleated cells) may also contain sequences necessary for the termination of transcription which may affect mRNA expression. These regions are transcribed as polyadenylated segments in the untranslated portion of the mRNA encoding tissue factor protein. The 3′ untranslated regions also include transcription termination sites. It is preferred that the transcription unit also contains a polyadenylation region. One benefit of this region is that it increases the likelihood that the transcribed unit will be processed and transported like mRNA. The identification and use of polyadenylation signals in expression constructs is well established. It is preferred that homologous polyadenylation signals be used in the transgene constructs. B. Cell Delivery Systems There are a number of compositions and methods which can be used to deliver nucleic acids to cells, either in vitro or in vivo. These methods and compositions can largely be broken down into two classes: viral based delivery systems and non-viral based delivery systems. For example, nucleic acids can be delivered through a number of direct delivery systems such as electroporation, lipofection, calcium phosphate precipitation, plasmids, viral vectors, viral nucleic acids, phage nucleic acids, phages, cosmids, or via transfer of genetic material in cells or carriers such as cationic liposomes. Appropriate means for transfection, including viral vectors, chemical transfectants, or physico-mechanical methods such as electroporation and direct diffusion of DNA, are well known in the art and readily adaptable for use with the compositions and methods described herein. Transfer vectors can be any nucleotide construction used to deliver genetic material into cells. In some embodiments the vectors are derived from either a virus or a retrovirus. Viral vectors include, for example, Adenovirus, Adeno-associated virus, Herpes virus, Vaccinia virus, Polio virus, AIDS virus, neuronal trophic virus, Sindbis and other RNA viruses, including these viruses with the HIV backbone. Typically, viral vectors contain nonstructural early genes, structural late genes, an RNA polymerase III transcript, inverted terminal repeats necessary for replication and encapsidation, and promoters to control the transcription and replication of the viral genome. When engineered as vectors, viruses typically have one or more of the early genes removed and a gene or gene/promotor cassette is inserted into the viral genome in place of the removed viral DNA. The necessary functions of the removed early genes are typically supplied by cell lines which have been engineered to express the gene products of the early genes in trans. Nucleic acids can also be delivered through electroporation, sonoporation, lipofection, or calcium phosphate precipitation. Lipofection involves the use liposomes, including cationic liposomes (e.g., DOTMA, DOPE, DC-cholesterol) and anionic liposomes, to delivery genetic material to a cell. Commercially available liposome preparations include LIPOFECTIN, LIPOFECTAMINE (GIBCO-BRL, Inc., Gaithersburg, Md.), SUPERFECT (Qiagen, Inc. Hilden, Germany), and TRANSFECTAM (Promega Biotec, Inc., Madison, Wis.). As discussed in more detail below, nucleic acids that are delivered to cells which are to be integrated into the host cell genome, can contain integration sequences. C. Markers The vectors used to deliver the disclosed nucleic acids to cells can further include nucleic acid sequence encoding a marker product. This marker product is used to determine if the gene has been delivered to the cell and once delivered is being expressed. In some embodiments the marker is a detectable label. Exemplary labels include the In some embodiments the marker may be a selectable marker. Examples of suitable selectable markers for mammalian cells are dihydrofolate reductase (DHFR), thymidine kinase, neomycin, neomycin analog G418, hydromycin, and puromycin. When such selectable markers are successfully transferred into a mammalian host cell, the transformed mammalian host cell can survive if placed under selective pressure. There are two widely used distinct categories of selective regimes. The first category is based on a cell's metabolism and the use of a mutant cell line which lacks the ability to grow independent of a supplemented media. The second category is dominant selection which refers to a selection scheme used in any cell type and does not require the use of a mutant cell line. These schemes typically use a drug to arrest growth of a host cell. Those cells which have a novel gene would express a protein conveying drug resistance and would survive the selection. A. Incorporation of Non-Canonical Amino Acids Methods for incorporating one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids into polypeptides, proteins and other sequence programmed polymeric materials are disclosed. The methods can be used to insert, for example, one or more iterations of a single dipeptide, non-standard-, non-natural-, or non-α-amino acid, or one or more iterations of two or more different one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids. The non-standard amino acid or non-standard amino acid(s) are typically selected by the practitioner based on the side chain and the desired properties and/or use of the polypeptide as discussed in more detail below. Proteins containing β3-amino acids have enormous usefulness for biotechnology, as β3-amino acid linkages can exhibit both enhanced protease resistance and uniquely altered immunogenicity (Seebach, et al., Polypeptides including one or more iterations of one or more different non-standard amino acids made utilizing the disclosed engineered ribosomes are also provided. The polypeptide can have any sequence dictated by the practitioner. As discussed herein, the practitioner can design a heterologous mRNA encoding the polypeptide can designed to encode at least one iterations of a dipeptide, non-standard-, non-natural-, or non-α-amino acid. The polypeptides can be monomeric or polymeric. A monomer is a molecule capable of reacting with identical or different molecules to form a polymer. Therefore, in some embodiments, the heterologous mRNA encodes a single subunit that can be part of a larger homomeric or heteromeric macromolecule. The compositions and methods can be used to produce sequence-defined polymers. In other embodiments, the mRNA encodes two or more subunits, for example, two or more repeats of a monomer. In some embodiments, the mRNA encodes a fusion protein including a sequence having at least one non-standard amino acid fused to a sequence of another protein of interest. Accordingly, the polypeptide including one or more non-standard amino acids can be part of a tag or a domain of a larger multiunit polypeptide. The polypeptide can include both standard and non-standard amino acids. In some embodiments, the biomolecule consists of a run of consecutive non-standard amino acids, (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more), or consists entirely of non-standard amino acids. All iterations of non-standard amino acids can be the same, or the biomolecule can include combinations of two, three, four, or more non-standard amino acids. For example, the compositions can be used to create higher order combinations of monomers to create block polymers with more diverse chemistries. In some embodiments, the polypeptide has any integer “n” from 1 to 500 of a dipeptide, non-standard-, non-natural-, or non-α-amino acid. In some embodiments, “n” is more than 500. The compositions and methods allow for template-based biosynthesis of polymers of, in principle, any length including multiple instances of nonstandard amino acids. The method involves the use of ribosomes, tRNAs, synthetases or a combination thereof in the translation process for a target polypeptide from mRNA. At least one of the synthetases can charge a cognate tRNA with a dipeptide, non-standard-, non-natural-, or non-α-amino acid. The resulting aminoacyl-tRNA recognizes at least one codon in the mRNA for the target protein, such as the codon corresponding to the anticodon of the aminoacyl-tRNA (e.g., a stop codon, or a natural or engineered codon to the binds to the aminoacyl-tRNA's anticodon). The Examples below show that EF-Tu mediates the entry of the aminoacyl-RNA charged with diverse β3-amino acids into a free site of the ribosome, hydrolyzes guanosine triphosphate (GTP) into guanosine diphosphate (GDP) and inorganic phosphate, and changes in conformation to dissociate from the tRNA molecule. The dipeptide, non-standard-, non-natural-, or non-α-amino acid-charged tRNA then fully enters the A site, where its amino acid is brought near the P site's polypeptide and the ribosome catalyzes the covalent transfer of the amino acid onto the polypeptide. In some embodiments, the EF-Tu is a wildtype EF-Tu. In some embodiments, the EF-Tu in a variant or mutant, for example, one that has improved binding or enzymatic activity, particularly with respect to aminoacyl-RNA charged with a dipeptide, non-standard-, non-natural-, or non-α-amino acid, or a ribosome that mediates translation thereof. In preferred embodiments, an engineered ribosome, such a ribosome including the disclosed engineered 23S rRNA is utilized to improve the kcat, kMor a combination thereof in one or more catalytic steps (e.g., aminoacylation, etc.) of the translation process that results in incorporation of a or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids into a nascent peptide chain. 1. In vitro Transcription/Translation The nucleic acids encoding ribosomes, tRNAs, synthetases or a combination thereof can be synthesized prior to translation of the target protein and used to incorporate dipeptides, non-standard-, non-natural-, or non-α-amino acids into a target protein in a cell-free (in vitro) protein synthesis system. In vitro protein synthesis systems involve the use crude extracts containing all the macromolecular components (70S or 80S ribosomes, tRNAs, aminoacyl-tRNA synthetases, initiation, elongation and termination factors, etc.) required for translation of exogenous RNA. For example, the tRNAs, aminoacyl-tRNA synthetases, and elongation factors in the crude extract can be supplemented with additional wildtype, mutant, or engineered ribosomes (or a ribosomal rRNA thereof), tRNAs, or synthetases or a combination thereof. To ensure efficient translation, each extract can be supplemented with amino acids, energy sources (ATP, GTP), energy regenerating systems (creatine phosphate and creatine phosphokinase for eukaryotic systems, and phosphoenol pyruvate and pyruvate kinase for the In vitro protein synthesis does not depend on having a polyadenylated RNA, but if having a poly(A) tail is essential for some other purpose, a vector may be used that has a stretch of about 100 A residues incorporated into the polylinker region. That way, the poly(A) tail is “built in” by the synthetic method. In addition, eukaryotic ribosomes read RNAs that have a 5′ methyl guanosine cap more efficiently. RNA caps can be incorporated by initiation of transcription using a capped base analogue, or adding a cap in a separate in vitro reaction post-transcriptionally. Suitable in vitro transcription/translation systems include, but are not limited to, the rabbit reticulocyte system, the 2. In vivo Methods Translation can also be carried out in vivo. Host cells and organisms can also incorporate one or more dipeptides, non-standard-, non-natural-, or non-α-amino acids into proteins or polypeptides via nucleic acids encoding wildtype, mutant, or engineered ribosomes (or a ribosomal rRNA thereof), tRNAs, or synthetases or a combination thereof. Nucleic acids encoding these components operably linked to one or more expression control sequences are introduced into cells or organisms using a cell delivery system. These cells also contain a gene encoding the target protein operably linked to an expression control sequence. Suitable organisms include, but are not limited to, microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with viral expression vectors (e.g., baculovirus); plant cell systems transformed with viral expression vectors (e.g., cauliflower mosaic virus, CaMV, or tobacco mosaic virus, TMV) or with bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems. It will be understood by one of ordinary skill in the art that regardless of the system used (i.e. in vitro or in vivo), expression of genes encoding ribosomes (or a ribosomal rRNA thereof), tRNAs, and synthetases will result in site specific incorporation of the dipeptide, non-standard-, non-natural-, or non-α-amino acid into the target polypeptides or proteins that are translated in the system. Host cells are genetically engineered (e.g., transformed, transduced or transfected) with the vectors encoding ribosomes (or a ribosomal rRNA thereof), tRNAs, synthetases or a combination thereof, which can be, for example, a cloning vector or an expression vector. The vector can be, for example, in the form of a plasmid, a bacterium, a virus, a naked polynucleotide, or a conjugated polynucleotide. The vectors are introduced into cells and/or microorganisms by standard methods including electroporation, infection by viral vectors, high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface. Such vectors can optionally contain one or more promoter. Kits are commercially available for the purification of plasmids from bacteria, (see, e.g., GFX™ Micro Plasmid Prep Kit from GE Healthcare; Strataprep® Plasmid Miniprep Kit and StrataPrep® EF Plasmid Midiprep Kit from Stratagene; GenElute™ HP Plasmid Midiprep and Maxiprep Kits from Sigma-Aldrich, and, Qiagen plasmid prep kits and QIAfilter kits from Qiagen). The isolated and purified plasmids are then further manipulated to produce other plasmids, used to transfect cells or incorporated into related vectors to infect organisms. Typical vectors contain transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular target nucleic acid. The vectors optionally comprise generic expression cassettes containing at least one independent terminator sequence, sequences permitting replication of the cassette in eukaryotes, or prokaryotes, or both, (e.g., shuttle vectors) and selection markers for both prokaryotic and eukaryotic systems. Following introduction of an expression vector by electroporation, lipofection, calcium phosphate, or calcium chloride co-precipitation, DEAE dextran, or other suitable transfection method, stable cell lines can be selected (e.g., by metabolic selection, or antibiotic resistance to G418, kanamycin, or hygromycin or by metabolic selection using the Glutamine Synthetase-NSO system). The transfected cells can be cultured such that the polypeptide of interest is expressed, and the polypeptide can be recovered from, for example, the cell culture supernatant or from lysed cells. Methods of engineering a microorganism or cell line to incorporate a nucleic acid sequence into its genome are known in the art. Nucleic acids that are delivered to cells which are to be integrated into the host cell genome can contain integration sequences. These sequences are often viral related sequences, particularly when viral based systems are used. These viral integration systems can also be incorporated into nucleic acids which are to be delivered using a non-nucleic acid based system of deliver, such as a liposome, so that the nucleic acid contained in the delivery system can become integrated into the host genome. Techniques for integration of genetic material into a host genome are also known and include, for example, systems designed to promote homologous recombination with the host genome. These systems typically rely on sequence flanking the nucleic acid to be expressed that has enough homology with a target sequence within the host cell genome that recombination between the vector nucleic acid and the target nucleic acid takes place, causing the delivered nucleic acid to be integrated into the host genome. These systems and the methods necessary to promote homologous recombination are known to those of skill in the art. For example, cloning vectors expressing a transposase and containing a nucleic acid sequence of interest between inverted repeats transposable by the transposase can be used to clone the stably insert the gene of interest into a bacterial genome (Barry, Integrative plasmids can be used to incorporate nucleic acid sequences into yeast chromosomes. See for example, Taxis and Knop, Prokaryotes useful as host cells include, but are not limited to, gram negative or gram positive organisms such as In a prokaryotic host cell, a polypeptide may include an N-terminal methionine residue to facilitate expression of the recombinant polypeptide in the prokaryotic host cell. The N-terminal Met may be cleaved from the expressed recombinant polypeptide. Promoter sequences commonly used for recombinant prokaryotic host cell expression vectors include lactamase and the lactose promoter system. Expression vectors for use in prokaryotic host cells generally comprise one or more phenotypic selectable marker genes. A phenotypic selectable marker gene is, for example, a gene encoding a protein that confers antibiotic resistance or that supplies an autotrophic requirement. Examples of useful expression vectors for prokaryotic host cells include those derived from commercially available plasmids such as the cloning vector pBR322 (ATCC 37017). pBR322 contains genes for ampicillin and tetracycline resistance and thus provides simple means for identifying transformed cells. To construct an expression vector using pBR322, an appropriate promoter and a DNA sequence are inserted into the pBR322 vector. Other commercially available vectors include, for example, T7 expression vectors from Invitrogen, pET vectors from Novagen and PALTER® vectors and PinPoint® vectors from Promega Corporation. Yeasts useful as host cells include, but are not limited to, those from the genus Mammalian or insect host cell culture systems well known in the art can also be employed to express ribosomes (or a ribosomal rRNA thereof), tRNAs, synthetases or a combination thereof for producing proteins or polypeptides containing one or more dipeptides, non-standard-, non-natural-, or non-α-amino acids. Commonly used promoter sequences and enhancer sequences are derived from Polyoma virus, Adenovirus 2, Simian Virus 40 (SV40), and human cytomegalovirus. DNA sequences derived from the SV40 viral genome may be used to provide other genetic elements for expression of a structural gene sequence in a mammalian host cell, e.g., SV40 origin, early and late promoter, enhancer, splice, and polyadenylation sites. Viral early and late promoters are particularly useful because both are easily obtained from a viral genome as a fragment which may also contain a viral origin of replication. Exemplary expression vectors for use in mammalian host cells are well known in the art. The host organism can be a genomically recoded organism “GRO.” Typically, the GRO is a bacterial strain, for example, an Different organisms often show particular preferences for one of the several codons that encode the same amino acid, and some codons are considered rare or infrequent. Preferably, the replaced codon is one that is rare or infrequent in the genome. The replaced codon can be one that codes for an amino acid (i.e., a sense codon) or a translation termination codon (i.e., a stop codon). GRO that are suitable for use as host or parental strains for the disclosed systems and methods are known in the art, or can be constructed using known methods. See, for example, Isaacs, et al., Preferably, the replaced codon is one that codes for a rare stop codon. In a particular embodiment, the GRO is one in which all instances of the UAG (TAG) codon have been removed and replaced by another stop codon (e.g., TAA, TGA), and preferably wherein release factor 1 (RF1; terminates translation at UAG and UAA) has also been deleted, eliminating translational termination at UAG codons (Lajoie, et al., Stop codons include TAG (UAG), TAA (UAA), and TGA (UGA). Although recoding to UAG (TAG) is discussed in more detail above, it will be appreciated that either of the other stop codons (or any sense codon) can be recoded using the same strategy. Accordingly, in some embodiments, a sense codon is reassigned, e.g., AGG or AGA to CGG, CGA, CGC, or CGG (arginine), e.g., as the principles can be extended to any set of synonymous or even non-synonymous codons, that are coding or non-coding. Similarly, the cognate translation machinery can be removed/mutated/deleted to remove natural codon function (UAG—RF1, UGA—RF2). The orthogonal translation system, particularly the antisense codon of the tRNA, can be designed to match the reassigned codon. GRO can have two, three, or more codons replaced with a synonymous or non-synonymous codon. Such GRO allow for reintroduction of the two, three, or more deleted codons in one or more recoded genes of interest, each dedicated to a different non-standard amino acid. Such GRO can be used in combination with the appropriate orthogonal translation machinery to produce polypeptides having two, three, or more different non-standard amino acids. B. Exemplary Applications Since macromolecules of different chemical composition generally do not form homogeneous mixtures, copolymerization of different monomers into the same polymer chain is the practical analog of alloying in polymer materials science. However, most synthetic routes to copolymers produce significant distributions in both composition and sequence within a single sample. As a result, synthesis methods with the precise sequence and architectural control needed to establish meaningful structure-function relationships have remained firmly out of reach. By providing a means to control sequence and architecture, the disclosed compositions and methods provide a path to polymers with previously unimaginable structures and functions. Amide bond formation by a wildtype ribosome follows a classic pathway. An amine nucleophile appended to a ribosome-bound tRNA attacks a proximal ester carbonyl to generate a tetrahedral intermediate, which then breaks down to product—an α-peptide ( Sequence control and local order lead to unique deliverables. Sequence control can be used to implement a local degree of order in the macromolecular material. Local order reflects side chain packing—it is analogous to crystallization if the order persists over a long length scale—and can dramatically affect the function of a polymeric material. High local order produces tough, hard regions and low local order produces malleable, elastic regions. The proportions of these two regions can be altered to finely tune mechanical properties. Exemplary polymers include sequence-defined polyolefins, aramids, polyurethanes, and polycarbonates. For example, in polyolefins such as polyethylene or polypropylene, manipulation of branching and stereoregularity affects the degree of crystallinity and domain structure. In polyurethanes, mixtures of hard and soft segments produce materials with a wide range of properties suitable for vehicle body parts (tough) or seat cushion foam (soft). In another example, aramids are temperature-resistant fibers used by the aerospace industry and by the military for body armor and ballistic composites, and depending on the monomer composition (meta vs. para, or the polyhydroquinone-diimidazopyridine subunit in M5), possess vastly different strengths, heat-resistances, and weights. Lastly, polycarbonates are structurally strong, robust materials that can be optically transparent, with diverse applications in protective, high temperature, electronic, and optical devices. Peptides and polymers can include, for example, 1,3 diketones, aromatic backbones, polyurethane backbones, etc. Beyond the production of useful novel polymers, the power of the engineered translation apparatus to accommodate a wide variety of non-biological monomers represents an unprecedented technology for producing polymers with extensive post-translational chemical activity. In particular, the incorporation of ring-opening metathesis polymerization (ROMP) precursors of differing reactivity provides great scope for new materials built from primary sequences. C. Purifying Proteins Containing Non-Canonical Amino Acids Proteins or polypeptides containing one or more dipeptides, non-standard-, non-natural-, or non-α-amino acids can be purified, either partially or substantially to homogeneity, according to standard procedures known to and used by those of skill in the art including, but not limited to, ammonium sulfate or ethanol precipitation, acid or base extraction, column chromatography, affinity column chromatography, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography, lectin chromatography, and gel electrophoresis. Protein refolding steps can be used, as desired, in making correctly folded mature proteins. High performance liquid chromatography (HPLC), affinity chromatography or other suitable methods can be employed in final purification steps where high purity is desired. In one embodiment, antibodies made against proteins containing the one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids are used as purification reagents, e.g., for affinity-based purification of proteins containing the one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids. In some embodiments, dipeptide, or non-standard-, non-natural-, or non-α-amino acid-containing polypeptides can be engineered to contain an additional domain containing amino acid sequence that allows the polypeptides to be captured onto an affinity matrix. For example, an Fc-containing polypeptide in a cell culture supernatant or a cytoplasmic extract can be isolated using a protein A column. In addition, a tag such as c-myc, hemagglutinin, polyhistidine, or Flag™ (Kodak) can be used to aid polypeptide purification. Such tags can be inserted anywhere within the polypeptide, including at either the carboxyl or amino terminus. Other fusions that can be useful include enzymes that aid in the detection of the polypeptide, such as alkaline phosphatase. Immunoaffinity chromatography also can be used to purify polypeptides. Polypeptides can additionally be engineered to contain a secretory signal (if there is not a secretory signal already present) that causes the protein to be secreted by the cells in which it is produced. The secreted proteins can then conveniently be isolated from the cell media. Once purified, partially or to homogeneity, as desired, the polypeptides may be used as assay components, therapeutic reagents, immunogens for antibody production, etc. Specific applications include the development of therapeutic antibodies that are more stable and less immunogenic by virtue of selective β3-amino acid insertion. Peptides containing β-amino acids can also assemble into protein-like tertiary and quaternary structures. When composed solely of β-amino acids, the structures formed, defined assemblies of 14-helices called β-peptide bundles, fold cooperatively in water solvent into unique and discrete quaternary assemblies that are highly thermostable, bind complex substrates and metal ion cofactors, and, in certain cases, catalyze chemical reactions (Wang and Schepartz, Those of skill in the art will recognize that, after synthesis, expression and/or purification, proteins can possess conformations different from the desired conformations of the relevant polypeptides. For example, polypeptides produced by prokaryotic systems often are optimized by exposure to chaotropic agents to achieve proper folding. During purification from lysates derived from It is occasionally desirable to denature and reduce expressed polypeptides and then to cause the polypeptides to re-fold into the preferred conformation. For example, guanidine, urea, DTT, DTE, and/or a chaperonin can be added to a translation product of interest. Methods of reducing, denaturing and renaturing proteins are well known to those of skill in the art. Refolding reagents can be flowed or otherwise moved into contact with the one or more polypeptide or other expression product, or vice-versa. Kits for producing polypeptides and/or proteins containing one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids are also provided. For example, a kit for producing a protein that contains one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids in a cell is provided, where the kit includes a polynucleotide sequence encoding wildtype, mutant, or engineered ribosomes (or a ribosomal rRNA thereof), tRNAs, or synthetases or a combination thereof. In one embodiment, the kit further includes one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids. In another embodiment, the kit includes a polynucleotide sequence encoding wildtype, mutant, or engineered ribosomes (or a ribosomal rRNA thereof), tRNAs, or synthetases or a combination thereof, and optionally includes one or more dipeptides, or non-standard-, non-natural-, or non-α-amino acids. Any of the kits can include instructional materials for producing the protein. The present invention will be further understood by reference to the following non-limiting examples. Czekster, et al., Purchased Materials α-Amino acids, β3-phenylalanine (β3-Phe), β3-tyrosine (β3-Tyr), β3-glycine (β3-Gly) and all other chemicals were purchased from Sigma-Aldrich (St. Louis, Mo.) unless otherwise noted. β3-methionine (β3-Met) and β3-glutamic acid (β3-Glu) were purchased from PepTech Corp. (Burlington, Mass.). [γ-32P]-ATP and tetrasodium-[32P]-pyrophosphate [32P]-NaPPi]) were from Perkin Elmer (Waltham, Mass.). Enzcheck Pyrophosphate assay kit was from Thermo Fisher Scientific. All tRNAs used for experiments in Examples 1 and 3 (except for tRNAGly, whose preparation is described below) were purchased from MP Biomedicals and are “natural”, that is, isolated from Plasmids Plasmids encoding Preparation of tRNAGly Pre-Treatment of Commercial tRNAs Commercial tRNAs were resuspended in 100 mM borate buffer (pH 8.0) and incubated at 37° C. for one hour to ensure complete deacylation (Effraim, et al., Expression and Purification of aaRS Enzymes and EF-Tu Plasmids encoding Kinetic Analysis of α- and β-Amino Acid Adenylation i. Adenylation of α- and β-Amino Acids Catalyzed by In Equation 1, v is the apparent relative specific activity (relative32P-ATP formed per minute) obtained at each substrate concentration divided by the enzyme concentration, RSA is the relative specific activity, S is the concentration of substrate, and KMis the Michaelis-Menten constant. For GluRS, GlyRS, MetRS, and PheRS, RSA has units of relative32P-ATP formed min−1×μM−1enzyme, since there is no direct conversion to32P-ATP concentration.32P-ATP formed could be quantified if a32P-ATP standard curve was run at the same time each experiment was performed (in the same membrane) but because the focus was direct comparison between α and β3-amino acids all amino acid concentrations, times quenched, and negative controls for both substrates in the membrane were included (excluding the32P-ATP standard curve). ii. Adenylation of α- and β-Tyr catalyzed by iii. Preparation of32P-tRNA substrates for aminoacylation reactions. BL21(DE3) cells were transformed with pQE30, encoding His6-tagged iv. Aminoacylation of α- and β3-amino acids. All tRNAs were prepared for aminoacylation by heating32P-tRNA (in 100 mM HEPES (pH 7.0)) to 95° C. for 3 min, and adding sufficient aminoacylation buffer (100 mM HEPES (pH 7.0), 100 mM KCl, 15 mM MgCl2) to ensure [32P-tRNA]=4 μM. This tRNA mixture was allowed to cool at RT for 30 min. During the cooling process, an amino acid mix was prepared containing α- or β3-amino acid (enzyme concentrations were as follows: TyrRS: 10 nM for α-Tyr, 60 nM for β3-Tyr; MetRS: 97 nM for α-Met, 97 nM for β3-Met; PheRS: 1.2 μM for α-Phe, 1.2 μM for β3-Phe; GlyRS: 100 nM for α-Gly, 500 nM for β3-Gly; GluRS: 500 nM for α-Glu, 5.01 μM for β3-Glu) in aminoacylation buffer supplemented with 8 mM ATP. Equal volumes of the tRNA and amino acid mix were combined, and enzyme was added to initiate the reaction. The final concentration of tRNA after mixing was 2 μM. Reactions were quenched at various time points by mixing 1 μL of the reaction mixture with 4 μL of P1 (Sigma) or S1 (Invitrogen) nuclease solution (0.5 U/μL final prepared from a 10 U/μL stock solution in 10 mM NaOAc (pH 5.0). PEI cellulose TLC plates were run as previously described (Ledoux, et al., v. Deacylation assays. Large scale (200 μL) aminoacylation reactions were initiated using the conditions described above (iv). The reactions were allowed to proceed for 1 h at 37° C., after which each reaction mixture was phenol/chloroform extracted. In each case, the aminoacylated tRNA product was ethanol precipitated, and the buffer was exchanged using a micro Bio-Spin 6 column (BioRad) following the procedure specified by the manufacturer and 100 mM HEPES (pH 8.0) containing 100 mM KCl. The precise extent of aminoacylation was calculated using the procedure described above; the 2 μM concentration corresponds to total aminoacylated tRNA. Assays were performed at 25° C. in a 50 μL reaction with 2 μM [32P]-aminoacyl-tRNA in 100 mM HEPES (pH 7.0) containing 100 mM KCl and 15 mM MgCl2. Reactions were initiated by addition of enzyme (enzyme concentrations were as follows: TyrRS: 1 μM; MetRS: 500 nM; PheRS: 500 nM; GlyRS: 2 μM for α-Gly; GluRS: 5.0 μM) and quenched at the indicated times by adding a 1 μL reaction aliquot to 4 μL of P1 (Sigma) or S1 (Invitrogen) nuclease solution (0.5 U/μL final prepared from a 10 U/μL stock solution in 10 mM NaOAc (pH 5.0). PEI cellulose TLC plates were run as previously described (Ledoux, et al., Although it is known that a handful of tRNA synthetases can utilize n-amino acids (notably β3-amino acids) as substrates, but no quantitative comparisons to natural substrates were ever performed (Hartman, et al., All aaRS enzymes evaluated prefer α-amino acid substrates during the adenylation phase of the complete reaction ( Only slightly different conclusions about α-/β3-amino acid specificity are evident when the complete aminoacylation reaction is considered ( The x-ray crystal structures PDB ID 1X8X ( To better understand the molecular basis for the observed differences in β3-amino acid tolerance, molecular dynamic simulations (MD) of TyrRS and PheRS, the aaRS enzymes representing the lowest and highest tolerance, respectively, for β3-amino acid substrates were carried out. Crystal structures of Determination of EF-Tu-aatRNA Equilibrium Dissociation Constants Aminoacylated tRNA was labeled with32P using CCA-adding enzyme as described above in (iii and iv). With these labeled tRNAs, equilibrium dissociation constants were determined using a standard RNA protection assay that monitored the extent of RNase A digestion of each32P-labeled aminoacyl tRNA as a function of [EF-Tu•GTP] (Asahara, et al., In equation 3, y represents the fraction of EF-Tu-aatRNA complex, EF-TuTrepresents the total concentration of EF-Tu, aatRNATrepresents the total concentration of aα-tRNA (10 nM), and KDis the equilibrium dissociation constant (all units of concentration are in nM). Once aminoacylated, tRNAs are delivered to the ribosome by the translation factor EF-Tu in complex with GTP. In some cases, EF-Tu interacts principally with the tRNA body, while in others it interacts with the amino acid side chain; these interactions are balanced to ensure efficient delivery of all twenty natural α-amino acids (LaRiviere, et al., Generation of Erythromycin-Resistant A library of erythromycin-resistant Screen of Erythromycin-Resistant Library for Sensitivity to Antibiotics To screen the resulting In this equation, OD600+Arepresents OD600of wells containing antibiotic and OD600−Arepresents OD600of wells lacking antibiotic. Screen of Erythromycin-Resistant Library for Sensitivity to β3-Puromycin The 1986 erythromycin-resistant clones identified above were then screened for sensitivity to β3-puromycin sensitivity as described above, except that 250 μM β3-puromycin was substituted for erythromycin. Expression of DHFR Containing β3-Amino Acids To evaluate the extent of in vivo β3-amino acid incorporation, BL21 (DE3) cells were co-transformed via electroporation (vide infra) with two plasmids. One plasmid (pET28a-DHFR-1) encoded an N-terminal His6-tagged DHFR variant containing a single Phe codon at position 128 and a single S to R mutation at position 126. The other plasmid encoded either the WT rrnb sequence (pLK35-rrnb), the 040329 mutant reported by Hecht (pLK35-040329.rrnb), or the P7A7 mutant (pLK35-P7A7.rrnb) identified during the puromycin sensitivity screen described above. i. Plasmid construction. pLK35-rrnb encodes a WT rrnb sequence and was obtained from the Dahlberg laboratory, Brown University. pLK35-m.rrnb plasmids encode mutant rrnb sequences identified from the β3-puromycin screen and were created by introducing the mutant 2051-2586 sequence into the pLK35-rrnb plasmid via Gibson Assembly (vide infra). pET28a-DHFR-1 was generated from pET28a-DHFR plasmid (Dr. Shinsuke Sando, University of Tokyo) by the addition of an N-terminal His-tag and by introducing mutations that changed the residue encoded at position 126 from Ser (codon TCG) to Arg (codon CGG). Mutations were introduced via Gibson Assembly. The amino acid sequence of DHFR is provided below. Following electroporation, cells were allowed to recover in 1 mL of SOB medium for 1 h at 37° C. and then plated on LB agar plates containing 50 ng/mL of kanamycin and 100 ng/mL of carbenicillin. After 18 h, dozens of individual colonies were present, from which a single colony was picked and grown overnight in 5 mL of LB containing 50 ng/mL of kanamycin and 100 ng/mL of carbenicillin. To confirm that both plasmids were maintained, plasmid DNA was purified using a Qiagen miniprep kit (product 27105) and sequenced by the Keck Foundation Biotechnology Resource Laboratory at Yale University. ii. β3-amino acid incorporation. The subsequent protocol for in vivo β3-amino acid incorporation employed minimal media and was adapted from procedures reported by Tirrell and Cropp (Liu, et al., Proteomic Analysis of Translated DHFR i. Generation of tryptic fragments. The incorporation of β3-Phe analogs into DHFR was verified by mass spectrometry, by examining the masses of peptides produced by in-gel trypsin digestions of Ni-NTA purified DHFR. Standard in-gel trypsin digestion procedures were performed to yield DHFR tryptic peptides. Briefly, 1 mm×1 mm minced gel pieces were washed three times with 100 μL of 50% acetonitrile/50 mM ammonium bicarbonate buffer (pH 8.0) followed by 500 μL of 100% acetonitrile to remove the bulk of Coomassie stain. The residual solvent was removed by aspiration, and the gel pieces were subsequently incubated with 10 mM dithiothreitol (DTT) in 50 mM ammonium bicarbonate (pH 8.0) (50-75 μL) for 1 h at 60° C. to reduce thiols. Following reduction, a solution of 20 mM iodoacetamide (IAA) in 50 mM ammonium bicarbonate (50-75 μL) was added and samples were incubated at 45° C. for 45 min. Reduced/alkylated gel pieces were then washed three times with 50 mM ammonium bicarbonate (1004) followed by 100% acetonitrile (504) and dried in a Speed Vac. Trypsin digestions were initiated upon addition of a 20 ng/μL solution of trypsin (Promega) in 50 mM ammonium bicarbonate in a sufficient volume to cover the gel pieces, and incubated on ice for 4 h and then overnight at 37° C. Tryptic peptides were extracted from the gel pieces with three 50 μL aliquots of a 50% acetonitrile/5% formic acid solution and once with 100% acetonitrile (50 μL). The collected tryptic peptides were dried in a Speed Vac prior to resuspending in 0.1% formic acid to a peptide concentration of 100 ng/μL. ii. Mass spectrometry. Tryptic peptides analyzed using an Agilent 6550 Q-TOF instrument were first separated on a Polaris-HR-Chip 3C18 (Agilent #G4240-62030) with a 360 nL trap column and a 75 μm ID×150 mm analytical column packed with 3 μm C18 particles. The capillary and nano pumps utilized 0.1% formic acid as eluent A and 90% acetonitrile with 0.1% formic acid as eluent B. The enrichment column was operated in a vented split design with a flow rate of 2.0 μL/min. The enrichment eluent composition was 2% B and the injection volume was 1 μL, which corresponds to 100 ng of injected peptide material. The sample flush volume for the ChipCube was 6 μL. The analytical column was operated at a flow rate of 0.3 μL/min with the following gradient: 2% B at 2 min, 40% B at 17 min, 70% B at 18 min, 70% B at 22 min, and 3% B at 23 min. At 20 min, the enrichment column was switched back to sample trapping to prepare for column equilibration prior to subsequent sample injection. Mass spectra were searched against the Building on the knowledge that BL21(DE3) cells expressing only WT ribosomes generated only trace amounts of DHFR when grown in unsupplemented 19/20 minimal media, or in media supplemented with β3-(p-Br)Phe or β3-Gly; higher levels of DHFR (approximately 8-fold) were observed when α-Phe was added. Cells expressing 040329 ribosomes along with WT ribosomes also generated trace amounts of DHFR when grown in unsupplemented 19/20 minimal media, however in this case, significant levels of DHFR were observed when the media was supplemented with β3-(p-Br)Phe or β3-Gly as well as α-Phe. To confirm that β3-(p-Br)Phe was incorporated at position 128 of the DHFR translated in these cells, the isolated full length (19 kDa) DHFR was digested with trypsin and analyzed by LC-MS/MS ( Experiments were designed to determine if ribosomes with improved efficiency and selectivity could be obtained by a more complete analysis of 23S rRNA sequence space. Additional diversity was introduced into the 040329 23S rRNA between positions 2496-2507, a region adjacent to the A-site, to generate >8000 unique clones (theoretical diversity=8192) and screened them to identify members that were both resistant to erythromycin (6.8 μM) and sensitive to β-puromycin (250 μM). Approximately 2000 clones were resistant to 6.8 μM erythromycin, showing <20% inhibition of growth relative to wild type ( Cells expressing P7A7 ribosomes along with WT ribosomes also generated trace amounts of DHFR when grown in unsupplemented 19/20 minimal media, however in this case, the highest levels of DHFR were observed when the media was supplemented with β3-(p-Br)Phe; lower levels were observed when the cells were treated with α-Phe or β3-Gly (CROSS-REFERENCE TO RELATED APPLICATIONS
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH
REFERENCE TO SEQUENCE LISTING
FIELD OF THE INVENTION
BACKGROUND OF THE INVENTION
SUMMARY OF THE INVENTION
BRIEF DESCRIPTION OF THE DRAWINGS
DETAILED DESCRIPTION OF THE INVENTION
I. Definitions
II. Designer Ribosomes
1. Exemplary Reference Sequences
(SEQ ID NO: 1) GGUUAAGCGACUAAGCGUACACGGUGGAUGCCCUGGCAGUCA GAGGCGAUGAAGGACGUGCUAAUCUGCGAUAAGCGUCGGUAA GGUGAUAUGAACCGUUAUAACCGGCGAUUUCCGAAUGGGGAA ACCCAGUGUGUUUCGACACACUAUCAUUAACUGAAUCCAUAG GUUAAUGAGGCGAACCGGGGGAACUGAAACAUCUAAGUACCC CGAGGAAAAGAAAUCAACCGAGAUUCCCCCAGUAGCGGCGAG CGAACGGGGAGCAGCCCAGAGCCUGAAUCAGUGUGUGUGUUA GUGGAAGCGUCUGGAAAGGCGCGCGAUACAGGGUGACAGCCC CGUACACAAAAAUGCACAUGCUGUGAGCUCGAUGAGUAGGGC GGGACACGUGGUAUCCUGUCUGAAUAUGGGGGGACCAUCCUC CAAGGCUAAAUACUCCUGACUGACCGAUAGUGAACCAGUACC GUGAGGGAAAGGCGAAAAGAACCCCGGCGAGGGGAGUGAAAA AGAACCUGAAACCGUGUACGUACAAGCAGUGGGAGCACGCUU AGGCGUGUGACUGCGUACCUUUUGUAUAAUGGGUCAGCGACU UAUAUUCUGUAGCAAGGUUAACCGAAUAGGGGAGCCGAAGGG AAACCGAGUCUUAACUGGGCGUUAAGUUGCAGGGUAUAGACC CGAAACCCGGUGAUCUAGCCAUGGGCAGGUUGAAGGUUGGGU AACACUAACUGGAGGACCGAACCGACUAAUGUUGAAAAAUUA GCGGAUGACUUGUGGCUGGGGGUGAAAGGCCAAUCAAACCGG GAGAUAGCUGGUUCUCCCCGAAAGCUAUUUAGGUAGCGCCUC GUGAAUUCAUCUCCGGGGGUAGAGCACUGUUUCGGCAAGGGG GUCAUCCCGACUUACCAACCCGAUGCAAACUGCGAAUACCGGA GAAUGUUAUCACGGGAGACACACGGCGGGUGCUAACGUCCGU CGUGAAGAGGGAAACAACCCAGACCGCCAGCUAAGGUCCCAA AGUCAUGGUUAAGUGGGAAACGAUGUGGGAAGGCCCAGACAG CCAGGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAAAGCG UAAUAGCUCACUGGUCGAGUCGGCCUGCGCGGAAGAUGUAAC GGGGCUAAACCAUGCACCGAAGCUGCGGCAGCGACGCUUAUG CGUUGUUGGGUAGGGGAGCGUUCUGUAAGCCUGCGAAGGUGU GCUGUGAGGCAUGCUGGAGGUAUCAGAAGUGCGAAUGCUGA CAUAAGUAACGAUAAAGCGGGUGAAAAGCCCGCUCGCCGGAA GACCAAGGGUUCCUGUCCAACGUUAAUCGGGGCAGGGUGAGU CGACCCCUAAGGCGAGGCCGAAAGGCGUAGUCGAUGGGAAAC AGGUUAAUAUUCCUGUACUUGGUGUUACUGCGAAGGGGGGAC GGAGAAGGCUAUGUUGGCCGGGCGACGGUUGUCCCGGUUUAA GCGUGUAGGCUGGUUUUCCAGGCAAAUCCGGAAAAUCAAGGC UGAGGCGUGAUGACGAGGCACUACGGUGCUGAAGCAACAAAU GCCCUGCUUCCAGGAAAAGCCUCUAAGCAUCAGGUAACAUCA AAUCGUACCCCAAACCGACACAGGUGGUCAGGUAGAGAAUAC CAAGGCGCUUGAGAGAACUCGGGUGAAGGAACUAGGCAAAAU GGUGCCGUAACUUCGGGAGAAGGCACGCUGAUAUGUAGGUGA GGUCCCUCGCGGAUGGAGCUGAAAUCAGUCGAAGAUACCAGC UGGCUGCAACUGUUUAUUAAAAACACAGCACUGUGCAAACAC GAAAGUGGACGUAUACGGUGUGACGCCUGCCCGGUGCCGGAA GGUUAAUUGAUGGGGUUAGCGCAAGCGAAGCUCUUGAUCGAA GCCCCGGUAAACGGCGGCCGUAACUAHAACGGUCCUAAGGUA GCGAAAUUCCUUGUCGGGUAAGUUCCGACCUGCACGAAUGGC GUAAUGAUGGCCAGGCUGUCUCCACCCGAGACUCAGUGAAAU UGAACUCGCUGUGAAGAUGCAGUGUACCCGCGGCAAGACGGA AAGACCCCGUGAACCUUUACUAUAGCUUGACACUGAACAUUG AGCCUUGAUGUGUAGGAUAGGUGGGAGGCUUUGAAGUGUGGA CGCCAGUCUGCAUGGAGCCGACCUUGAAAUACCACCCUUUAAU GUUUGAUGUUCUAACGUUGACCCGUAAUCCGGGUUGCGGACA GUGUCUGGUGGGUAGUUUGACUGGGGCGGUCUCCUCCUAAAG AGUAACGGAGGAGCACGAAGGUUGGCUAAUCCUGGUCGGACA UCAGGAGGUUAGUGCAAUGGCAUAAGCCAGCUUGACUGCGAG CGUGACGGCGCGAGCAGGUGCGAAAGCAGGUCAUAGUGAUCC GGUGGUUCUGAAUGGAAGGGCCAUCGCUCAACGGAUAAAAGG UACUCCGGGGAUAACAGGCUGAUACCGCCCAAGAGUUCAUAU CGACGGCGGUGUUUGGCACCUCGAUGUCGGCUCAUCACAUC CUGGGGCUGAAGUAGGUCCCAAGGGUAUGGCUGUUCGCCAUU UAAAGUGGUACGCGAGCUGGGUUUAGAACGUCGUGAGACAGU UCGGUCCCUAUCUGCCGUGGGCGCUGGAGAACUGAGGGGGGC UGCUCCUAGUACGAGAGGACCGGAGUGGACGCAUCACUGGUG UUCGGGUUGUCAUGCCAAUGGCACUGCCCGGUAGCUAAAUGC GGAAGAGAUAAGUGCUGAAAGCAUCUAAGCACGAAACUUGCC CCGAGAUGAGUUCUCCCUGACCCUUUAAGGGUCCUGAAGGAA CGUUGAAGACGACGACGUUGAUAGGCCGGGUGUGUAAGCGCA GCGAUGCGUUGAGCUAACCGGUACUAAUGAACCGUGAGGCUU AACCUU
(Genomic sequence at NCBI Reference Sequence: NC_000913.3), or a functional fragment thereof. Positions 2057-2063 and 2502-2507, referenced extensively herein, are bolded and underlined.
(SEQ ID NO: 2) GGUUAAGCGACUAAGCGUACACGGUGGAUGCCCUGGCAGUCA GAGGCGAUGAAGGACGUGCUAAUCUGCGAUAAGCGUCGGUAA GGUGAUAUGAACCGUUAUAACCGGCGAUUUCCGAAUGGGGAA ACCCAGUGUGUUUCGACACACUAUCAUUAACUGAAUCCAUAG GUUAAUGAGGCGAACCGGGGGAACUGAAACAUCUAAGUACCC CGAGGAAAAGAAAUCAACCGAGAUUCCCCCAGUAGCGGCGAG CGAACGGGGAGCAGCCCAGAGCCUGAAUCAGUGUGUGUGUUA GUGGAAGCGUCUGGAAAGGCGCGCGAUACAGGGUGACAGCCC CGUACACAAAAAUGCACAUGCUGUGAGCUCGAUGAGUAGGGC GGGACACGUGGUAUCCUGUCUGAAUAUGGGGGGACCAUCCUC CAAGGCUAAAUACUCCUGACUGACCGAUAGUGAACCAGUACC GUGAGGGAAAGGCGAAAAGAACCCCGGCGAGGGGAGUGAAAA AGAACCUGAAACCGUGUACGUACAAGCAGUGGGAGCACGCUU AGGCGUGUGACUGCGUACCUUUUGUAUAAUGGGUCAGCGACU UAUAUUCUGUAGCAAGGUUAACCGAAUAGGGGAGCCGAAGGG AAACCGAGUCUUAACUGGGCGUUAAGUUGCAGGGUAUAGACC CGAAACCCGGUGAUCUAGCCAUGGGCAGGUUGAAGGUUGGGU AACACUAACUGGAGGACCGAACCGACUAAUGUUGAAAAAUUA GCGGAUGACUUGUGGCUGGGGGUGAAAGGCCAAUCAAACCGG GAGAUAGCUGGUUCUCCCCGAAAGCUAUUUAGGUAGCGCCUC GUGAAUUCAUCUCCGGGGGUAGAGCACUGUUUCGGCAAGGGG GUCAUCCCGACUUACCAACCCGAUGCAAACUGCGAAUACCGGA GAAUGUUAUCACGGGAGACACACGGCGGGUGCUAACGUCCGU CGUGAAGAGGGAAACAACCCAGACCGCCAGCUAAGGUCCCAA AGUCAUGGUUAAGUGGGAAACGAUGUGGGAAGGCCCAGACAG CCAGGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAAAGCG UAAUAGCUCACUGGUCGAGUCGGCCUGCGCGGAAGAUGUAAC GGGGCUAAACCAUGCACCGAAGCUGCGGCAGCGACACUAUGU GUUGUUGGGUAGGGGAGCGUUCUGUAAGCCUGUGAAGGUGUG CUGUGAGGCAUGCUGGAGGUAUCAGAAGUGCGAAUGCUGACA UAAGUAACGAUAAAGCGGGUGAAAAGCCCGCUCGCCGGAAGA CCAAGGGUUCCUGUCCAACGUUAAUCGGGGCAGGGUGAGUCG ACCCCUAAGGCGAGGCCGAAAGGCGUAGUCGAUGGGAAACAG GUUAAUAUUCCUGUACUUGGUGUUACUGCGAAGGGGGGACGG AGAAGGCUAUGUUGGCCGGGCGACGGUUGUCCCGGUUUAAGC GUGUAGGCUGGUUUUCCAGGCAAAUCCGGAAAAUCAAGGCUG AGGCGUGAUGACGAGGCACUACGGUGCUGAAGCAACAAAUGC CCUGCUUCCAGGAAAAGCCUCUAAGAAUCAGGUAACAUCAAA UCGUACCCCAAACCGACACAGGUGGUCAGGUAGAGAAUACCA AGGCGCUUGAGAGAACUCGGGUGAAGGAACUAGGCAAAAUGG UGCCGUAACUUCGGGAGAAGGCACGCUGAUAUGUAGGUGAAG UCCCUCGCGGAUGGAGCUGAAAUCAGUCGAAGAUACCAGCUG GCUGCAACUGUUUAUUAAAAACACAGCACUGUGCAAACACGA AAGUGGACGUAUACGGUGUGACGCCUGCCCGGUGCCGGAAGG UUAAUUGAUGGGGUUAGCGCAAGCGAAGCUCUUGAUCGAAGC CCCGGUAAACGGCGGCCGUAACUAUAACGGUCCUAAGGUAGC GAAAUUCCUUGUCGGGUAAGUUCCGACCUGCACGAAUGGCGU AAUGAUGGCCAGGCUGUCUCCACCCGAGACUCAGUGAAAUUG AACUCGCUGUGAAGAUGCAGUGUACCCGCGGCAAGACGGAAA GACCCCGUGAACCUUUACUAUAACUUGACACUGAACAUUGAG CCUUGAUGUGUAGGAUAGGUGGGAGGCUUAGAAGUGUGGACG CCAGUCUGCAUGGAGCCGACCUUGAAAUACCACCCUUUAAUG UUUGAUGUUCUAACGUUGACCCGUAAUCCGGGUUGCGGACAG UGUCUGGUGGGUAGUUUGACUGGGGCGGUCUCCUCCUAAAGA GUAACGGAGGAGCACGAAGGUUGGCUAAUCCUGGUCGGACAU CAGGAGGUUAGUGCAAUGGCAUAAGCCAGCUUGACUGCGAGC GUGACGGCGCGAGCAGGUGCGAAAGCAGGUCAUAGUGAUCCG GUGGUUCUGAAUGGAAGGGCCAUCGCUCAACGGAUAAAAGGU ACUCCGGGGAUAACAGGCUGAUACCGCCCAAGAGUUCAUAUC GACGGCGGUGUUUGGCACCUCGAUGUCGGCUCAUCACAUCCU GGGGCUGAAGUAGGUCCCAAGGGUAUGGCUGUUCGCCAUUUA AAGUGGUACGCGAGCUGGGUUUAGAACGUCGUGAGACAGUUC GGUCCCUAUCUGCCGUGGGCGCUGGAGAACUGAGGGGGGCUG CUCCUAGUACGAGAGGACCGGAGUGGACGCAUCACUGGUGUU CGGGUUGUCAUGCCAAUGGCACUGCCCGGUAGCUAAAUGCGG AAGAGAUAAGUGCUGAAAGCAUCUAAGCACGAAACUUGCCCC GAGAUGAGUUCUCCCUGACCCUUUAAGGGUCCUGAAGGAACG UUGAAGACGACGACGUUGAUAGGCCGGGUGUGUAAGCGCAGC GAUGCGUUGAGCUAACCGGUACUAAUGAACCGUGAGGCUUAA CCUU
(Genomic sequence at GenBank: AF053966.1) or a functional fragment thereof. The nucleotide corresponding to positions 2057-2063 and 2502-2507 of SEQ ID NO:1, referenced extensively herein, are bolded and underlined at 2056-2062 and 2501-2506 of SEQ ID NO:2.
(SEQ ID NO: 3) AGCGUUCUUUGAAGUGCUCACACAGAUUGUCUGAUGAAAAUGA GCAGUAAAACCUCUACAGGCUUGUAGCUCAGGUGGUUAGAGCG CACCCCUGAUAAGGGUGAGGUCGGUGGUUCAAGUCCACUCAGG CCUACCAAAUUUGCACGGCAAAUUUGAAGAGGUUUUAACUACA UGUUAUGGGGCUAUAGCUCAGCUGGGAGAGCGCCUGCUUUGCA CGCAGGAGGUCUGCGGUUCGAUCCCGCAUAGCUCCACCAUCUCU GUAGUGAUUAAAUAAAAAAUACUUCAGAGUGUACCUGCAAAGG UUCACUGCGAAGUUUUGCUCUUUAAAAAUCUGGAUCAAGCUGA AAAUUGAAACACUGAACAACGAAAGUUGUUCGUGAGUCUCUCA AAUUUUCGCAACACGAUGAUGAAUCGAAAGAAACAUCUUCGGG UUGUGAGGUUAAGCGACUAAGCGUACACGGUGGAUGCCCUGGC AGUCAGAGGCGAUGAAGGACGUGCUAAUCUGCGAUAAGCGUCG GUAAGGUGAUAUGAACCGUUAUAACCGGCGAUUUCCGAAUGGG GAAACCCAGUGUGUUUCGACACACUAUCAUUAACUGAAUCCAU AGGUUAAUGAGGCGAACCGGGGGAACUGAAACAUCUAAGUACC CCGAGGAAAAGAAAUCAACCGAGAUUCCCCCAGUAGCGGCGAG CGAACGGGGAGCAGCCCAGAGCCUGAAUCAGUGUGUGUGUUAG UGGAAGCGUCUGGAAAGGCGUGCGAUACAGGGUGACAGCCCCG UACACAAAAAUGCACAUGCUGUGAGCUCGAUGAGUAGGGCGGG ACACGUGGUAUCCUGUCUGAAUAUGGGGGGACCAUCCUCCAAG GCUAAAUACUCCUGACUGACCGAUAGUGAACCAGUACCGUGAG GGAAAGGCGAAAAGAACCCCGGCGAGGGGAGUGAAAAAGAACC UGAAACCGUGUACGUACAAGCAGUGGGAGCACGCUUAGGCGUG UGACUGCGUACCUUUUGUAUAAUGGGUCAGCGACUUAUAUUCU GUAGCAAGGUUAACCGAAUAGGGGAGCCGAAGGGAAACCGAGU CUUAACUGGGCGUUAAGUUGCAGGGUAUAGACCCGAAACCCGG UGAUCUAGCCAUGGGCAGGUUGAAGGUUGGGUAACACUAACUG GAGGACCGAACCGACUAAUGUUGAAAAAUUAGCGGAUGACUUG UGGCUGGGGGUGAAAGGCCAAUCAAACCGGGAGAUAGCUGGUU CUCCCCGAAAGCUAUUUAGGUAGCGCCUCGUGAAUUCAUCUCCG GGGGUAGAGCACUGUUUCGGCAAGGGGGUCAUCCCGACUUACC AACCCGAUGCAAACUGCGAAUACCGGAGAAUGUUAUCACGGGA GACACACGGCGGGUGCUAACGUCCGUCGUGAAGAGGGAAACAA CCCAGACCGCCAGCUAAGGUCCCAAAGUCAUGGUUAAGUGGGA AACGAUGUGGGAAGGCCCAGACAGCCAGGAUGUUGGCUUUGAA GCAGCCAUCAUUUAAAGAAAGCGUAAUAGCUCACUGGUCGAGU CGGCCUGCGCGGAAGAUGUAACGGGGCUAAACCAUGCACCGAA GCUGCGGCAGCGACACUAUGUGUUGUUGGGUAGGGGAGCGUUC UGUAAGCCUGUGAAGGUGUGCUGUGAGGCAUGCUGGAGGUAUC AGAAGUGCGAAUGCUGACAUAAGUAACGAUAAAGCGGGUGAAA AGCCCGCUCGCCGGAAGACCAAGGGUUCCUGUCCAACGUUAAUC GGGGCAGGGUGAGUCGACCCCUAAGGCGAGGCCGAAAGGCGUA GUCGAUGGGAAACAGGUUAAUAUUCCUGUACUUGGUGUUACUG CGAAGGGGGGACGGAGAAGGCUAUGUUGGCCGGGCGACGGUUG UCCCGGUUUAAGCGUGUAGGCUGGUUUUCCAGGCAAAUCCGGA AAAUCAAGGCUGAGGCGUGAUGACGAGGCACUACGGUGCUGAA GCAACAAAUGCCCUGCUUCCAGGAAAAGCCUCUAAGCAUCAGG UAACAUCAAAUCGUACCCCAAACCGACACAGGUGGUCAGGUAG AGAAUACCAAGGCGCUUGAGAGAACUCGGGUGAAGGAACUAGG CAAAAUGGUGCCGUAACUUCGGGAGAAGGCACGCUGAUAUGUA GGUGAAGCGACUUGCUCGUGGAGCUGAAAUCAGUCGAAGAUAC CAGCUGGCUGCAACUGUUUAUUAAAAACACAGCACUGUGCAAA CACGAAAGUGGACGUAUACGGUGUGACGCCUGCCCGGUGCCGG AAGGUUAAUUGAUGGGGUUAGCCGCAAGGCGAAGCUCUUGAUC GAAGCCCCGGUAAACGGCGGCCGUAACUAUAACGGUCCUAAGG UAGCGAAAUUCCUUGUCGGGUAAGUUCCGACCUGCACGAAUGG CGUAAUGAUGGCCAGGCUGUCUCCACCCGAGACUCAGUGAAAU UGAACUCGCUGUGAAGAUGCAGUGUACCCGCGGCAAGACGAGC GUGACCCGUGAACCUUUACUAUAGCUUGACACUGAACAUUGAG CCUUGAUGUGUAGGAUAGGUGGGAGGCUUUGAAGUGUGGACGC CAGUCUGCAUGGAGCCGACCUUGAAAUACCACCCUUUAAUGUU UGAUGUUCUAACGUUGACCCGUAAUCCGGGUUGCGGACAGUGU CUGGUGGGUAGUUUGACUGGGGCGGUCUCCUCCUAAAGAGUAA CGGAGGAGCACGAAGGUUGGCUAAUCCUGGUCGGACAUCAGGA GGUUAGUGCAAUGGCAUAAGCCAGCUUGACUGCGAGCGUGACG GCGCGAGCAGGUGCGAAAGCAGGUCAUAGUGAUCCGGUGGUUC UGAAUGGAAGGGCCAUCGCUCAACGGAUAAAAGGUACUCCGGG GAUAACAGGCUGAUACCGCCCAAGAGUUCAUAUCGACGGCGGU GUUUGGCACCUCUGGCAGGGCUCAUCACAUCCUGGGGCUGAAG UAGGUCCCAAGGGUAUGGCUGUUCGCCAUUUAAAGUGGUACGC GAGCUGGGUUUAGAACGUCGUGAGACAGUUCGGUCCCUAUCUG CCGUGGGCGCUGGAGAACUGAGGGGGGCUGCUCCUAGUACGAG AGGACCGGAGUGGACGCAUCACUGGUGUUCGGGUUGUCAUGCC AAUGGCACUGCCCGGUAGCUAAAUGCGGAAGAGAUAAGUGCUG AAAGCAUCUAAGCACGAAACUUGCCCCGAGAUGAGUUCUCCCU GACUCCUUGAGAGUCCUGAAGGAACGUUGAAGACGACGACGUU GAUAGGCCGGGUGUGUAAGCGCAGCGAUGCGUUGAGCUAACCG GUACUAAUGAACCGUGAGGCUUAACCUUACAACGCCGAAGGUG UUUUGGCGGAUUGAGAGAAGAUUUUCAGCCUGAUACAGAUUAA AUCAGAACGCAGAAGCGGUCUGAUAAAACAGAAUUUGCCUGGC GGCAGUAGCGCGGUGGUCCCACCUGACCCCAUGCCGAACUCAGA AGUGAAACGCCGUAGCGCCGAUGGUAGUGUGGGGUCUCCUCAU GCGAGAGUAGGGAACUGCCAGGCAUCAAAUAAAACGAAAGGCU CAGUCGGAAGACUGGGCCUUUCGUUUUAUCUGUUGUUUGUCGG UGAACGCUCUCCUGAGUAGGACAAAUCCGCCGGGAGCGGAUUU GAACGUUGCGAAGCAACGGCCCGGAGGGUGGCGGGCAGGACGC CCGCCAUAAACUGCCAGGCAUCAAAUUAAGCAGAAGGCCAUCCU GACGGAUGGCCUUUUUGCAUUGGCGCAGAAA
(Dedkova, et al., 2. Exemplary Engineered 23S rRNA
(SEQ ID NO: 4) AGCGUUCUUUGAAGUGCUCACACAGAUUGUCUGAUGAAAAUGA GCAGUAAAACCUCUACAGGCUUGUAGCUCAGGUGGUUAGAGCG CACCCCUGAUAAGGGUGAGGUCGGUGGUUCAAGUCCACUCAGG CCUACCAAAUUUGCACGGCAAAUUUGAAGAGGUUUUAACUACA UGUUAUGGGGCUAUAGCUCAGCUGGGAGAGCGCCUGCUUUGCA CGCAGGAGGUCUGCGGUUCGAUCCCGCAUAGCUCCACCAUCUCU GUAGUGAUUAAAUAAAAAAUACUUCAGAGUGUACCUGCAAAGG UUCACUGCGAAGUUUUGCUCUUUAAAAAUCUGGAUCAAGCUGA AAAUUGAAACACUGAACAACGAAAGUUGUUCGUGAGUCUCUCA AAUUUUCGCAACACGAUGAUGAAUCGAAAGAAACAUCUUCGGG UUGUGAGGUUAAGCGACUAAGCGUACACGGUGGAUGCCCUGGC AGUCAGAGGCGAUGAAGGACGUGCUAAUCUGCGAUAAGCGUCG GUAAGGUGAUAUGAACCGUUAUAACCGGCGAUUUCCGAAUGGG GAAACCCAGUGUGUUUCGACACACUAUCAUUAACUGAAUCCAU AGGUUAAUGAGGCGAACCGGGGGAACUGAAACAUCUAAGUACC CCGAGGAAAAGAAAUCAACCGAGAUUCCCCCAGUAGCGGCGAG CGAACGGGGAGCAGCCCAGAGCCUGAAUCAGUGUGUGUGUUAG UGGAAGCGUCUGGAAAGGCGUGCGAUACAGGGUGACAGCCCCG UACACAAAAAUGCACAUGCUGUGAGCUCGAUGAGUAGGGCGGG ACACGUGGUAUCCUGUCUGAAUAUGGGGGGACCAUCCUCCAAG GCUAAAUACUCCUGACUGACCGAUAGUGAACCAGUACCGUGAG GGAAAGGCGAAAAGAACCCCGGCGAGGGGAGUGAAAAAGAACC UGAAACCGUGUACGUACAAGCAGUGGGAGCACGCUUAGGCGUG UGACUGCGUACCUUUUGUAUAAUGGGUCAGCGACUUAUAUUCU GUAGCAAGGUUAACCGAAUAGGGGAGCCGAAGGGAAACCGAGU CUUAACUGGGCGUUAAGUUGCAGGGUAUAGACCCGAAACCCGG UGAUCUAGCCAUGGGCAGGUUGAAGGUUGGGUAACACUAACUG GAGGACCGAACCGACUAAUGUUGAAAAAUUAGCGGAUGACUUG UGGCUGGGGGUGAAAGGCCAAUCAAACCGGGAGAUAGCUGGUU CUCCCCGAAAGCUAUUUAGGUAGCGCCUCGUGAAUUCAUCUCCG GGGGUAGAGCACUGUUUCGGCAAGGGGGUCAUCCCGACUUACC AACCCGAUGCAAACUGCGAAUACCGGAGAAUGUUAUCACGGGA GACACACGGCGGGUGCUAACGUCCGUCGUGAAGAGGGAAACAA CCCAGACCGCCAGCUAAGGUCCCAAAGUCAUGGUUAAGUGGGA AACGAUGUGGGAAGGCCCAGACAGCCAGGAUGUUGGCUUUGAA GCAGCCAUCAUUUAAAGAAAGCGUAAUAGCUCACUGGUCGAGU CGGCCUGCGCGGAAGAUGUAACGGGGCUAAACCAUGCACCGAA GCUGCGGCAGCGACACUAUGUGUUGUUGGGUAGGGGAGCGUUC UGUAAGCCUGUGAAGGUGUGCUGUGAGGCAUGCUGGAGGUAUC AGAAGUGCGAAUGCUGACAUAAGUAACGAUAAAGCGGGUGAAA AGCCCGCUCGCCGGAAGACCAAGGGUUCCUGUCCAACGUUAAUC GGGGCAGGGUGAGUCGACCCCUAAGGCGAGGCCGAAAGGCGUA GUCGAUGGGAAACAGGUUAAUAUUCCUGUACUUGGUGUUACUG CGAAGGGGGGACGGAGAAGGCUAUGUUGGCCGGGCGACGGUUG UCCCGGUUUAAGCGUGUAGGCUGGUUUUCCAGGCAAAUCCGGA AAAUCAAGGCUGAGGCGUGAUGACGAGGCACUACGGUGCUGAA GCAACAAAUGCCCUGCUUCCAGGAAAAGCCUCUAAGCAUCAGG UAACAUCAAAUCGUACCCCAAACCGACACAGGUGGUCAGGUAG AGAAUACCAAGGCGCUUGAGAGAACUCGGGUGAAGGAACUAGG CAAAAUGGUGCCGUAACUUCGGGAGAAGGCACGCUGAUAUGUA GGUGAAGCGACUUGCUCGUGGAGCUGAAAUCAGUCGAAGAUAC CAGCUGGCUGCAACUGUUUAUUAAAAACACAGCACUGUGCAAA CACGAAAGUGGACGUAUACGGUGUGACGCCUGCCCGGUGCCGG AAGGUUAAUUGAUGGGGUUAGCCGCAAGGCGAAGCUCUUGAUC GAAGCCCCGGUAAACGGCGGCCGUAACUAUAACGGUCCUAAGG UAGCGAAAUUCCUUGUCGGGUAAGUUCCGACCUGCACGAAUGG CGUAAUGAUGGCCAGGCUGUCUCCACCCGAGACUCAGUGAAAU UGAACUCGCUGUGAAGAUGCAGUGUACCCGCGGCAAGACGAGC GUGACCCGUGAACCUUUACUAUAGCUUGACACUGAACAUUGAG CCUUGAUGUGUAGGAUAGGUGGGAGGCUUUGAAGUGUGGACGC CAGUCUGCAUGGAGCCGACCUUGAAAUACCACCCUUUAAUGUU UGAUGUUCUAACGUUGACCCGUAAUCCGGGUUGCGGACAGUGU CUGGUGGGUAGUUUGACUGGGGCGGUCUCCUCCUAAAGAGUAA CGGAGGAGCACGAAGGUUGGCUAAUCCUGGUCGGACAUCAGGA GGUUAGUGCAAUGGCAUAAGCCAGCUUGACUGCGAGCGUGACG GCGCGAGCAGGUGCGAAAGCAGGUCAUAGUGAUCCGGUGGUUC UGAAUGGAAGGGCCAUCGCUCAACGGAUAAAAGGUACUCCGGG GAUAACAGGCUGAUACCGCCCAAGAGUUCAUAUCGACGGCGGU GUUUGGCACCUCUGACUUGGCUCAUCACAUCCUGGGGCUGAAG UAGGUCCCAAGGGUAUGGCUGUUCGCCAUUUAAAGUGGUACGC GAGCUGGGUUUAGAACGUCGUGAGACAGUUCGGUCCCUAUCUG CCGUGGGCGCUGGAGAACUGAGGGGGGCUGCUCCUAGUACGAG AGGACCGGAGUGGACGCAUCACUGGUGUUCGGGUUGUCAUGCC AAUGGCACUGCCCGGUAGCUAAAUGCGGAAGAGAUAAGUGCUG AAAGCAUCUAAGCACGAAACUUGCCCCGAGAUGAGUUCUCCCU GACUCCUUGAGAGUCCUGAAGGAACGUUGAAGACGACGACGUU GAUAGGCCGGGUGUGUAAGCGCAGCGAUGCGUUGAGCUAACCG GUACUAAUGAACCGUGAGGCUUAACCUUACAACGCCGAAGGUG UUUUGGCGGAUUGAGAGAAGAUUUUCAGCCUGAUACAGAUUAA AUCAGAACGCAGAAGCGGUCUGAUAAAACAGAAUUUGCCUGGC GGCAGUAGCGCGGUGGUCCCACCUGACCCCAUGCCGAACUCAGA AGUGAAACGCCGUAGCGCCGAUGGUAGUGUGGGGUCUCCUCAU GCGAGAGUAGGGAACUGCCAGGCAUCAAAUAAAACGAAAGGCU CAGUCGGAAGACUGGGCCUUUCGUUUUAUCUGUUGUUUGUCGG UGAACGCUCUCCUGAGUAGGACAAAUCCGCCGGGAGCGGAUUU GAACGUUGCGAAGCAACGGCCCGGAGGGUGGCGGGCAGGACGC CCGCCAUAAACUGCCAGGCAUCAAAUUAAGCAGAAGGCCAUCCU GACGGAUGGCCUUUUUGCAUUGGCGCAGAAA
or a functional fragment or variant thereof having at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity with SEQ ID NO:4, wherein the engineered 23S rRNA is not 100% identical to the 23 rRNA of SEQ ID NO:3 or a wildtype rRNA. The nucleotide corresponding to positions 2057-2063 and 2502-2507 of SEQ ID NO:1, referenced extensively herein, are bolded and underlined at 2495-2501 and 2940-2945 of SEQ ID NO:4. Preferably, the 23S rRNA includes at least UGACUU (nucleotides 2940-2945 of SEQ ID NO:4), and more preferably AGCGUGA (nucleotides 2495-2501 of SEQ ID NO:4). In some embodiments the 23S rRNA includes the entire domain V of SEQ ID NO:4, the PTC of SEQ ID NO:4, or a combination thereof.
III. Expression and Translation Systems
III. Methods
IV. Kits
EXAMPLES
Example 1
tRNA Synthetases can Utilize β-Amino Acids (Notably β3-Amino Acids) as Substrates
Materials and Methods
Gly_t7 TmGG AGC GGG AAA CGA GAC TCG AAC TCG CGA CCC CGA CCT TGG CAA GGT CGT GCT CTA CCA ACT GAG CTA TTC CCG CCT ATA GTG AGT CGT ATT A(SEQ ID NO: 5) T7pol_ CAT ATG TAA TAC GAC TCA CTA TAG Sequence (SEQ ID NO: 6) Results
Kinetic parameters for α- and β3-amino acid adenylation. kcat(min−1) or RSA Amino (32P-ATP formed Ratio KM Ratio kcat/KM Ratio acid min−1enzyme μM−1•) (α-/β-) (μM) (α-/β-) (μM−1· min−1) (α-/β-) α-Phe 59.1 ± 7.1 1.4 ± 0.3 52.8 ± 25.8 0.18 ± 0.11 1.1 ± 0.5 8.06 ± 5.63 β-Phe 41.6 ± 6.8 299.7 ± 136.6 0.14 ± 0.07 α-Gly 166.8 ± 12.8 1.14 ± 0.24 9.8 ± 3.5 0.14 ± 0.11 17.1 ± 6.3 7.97 ± 6.46 β-Gly 146.4 ± 29.2 68.4 ± 47.3 2.1 ± 1.5 α-Met 430 ± 38 1.4 ± 0.2 23.4 ± 8.0 0.70 ± 0.5 18.4 ± 6.5 1.98 ± 1.5 β-Met 310 ± 47 33.4 ± 22 9.3 ± 6.3 α-Glu 1349 ± 206 31.6 ± 6.4 76.4 ± 43.0 0.35 ± 0.27 17.6 ± 10.3 89.0 ± 70 β-Glu 42.7 ± 5.8 215.1 ± 110.1 0.19 ± 0.10 α-Tyr 1.22 ± 0.11 46.2 ± 7.7 21.4 ± 6.9 0.047 ± 0.03 0.06 ± 0.02 972.6 ± 632.0 β-Tyr 0.027 ± 0.001 450 ± 242.3 0.00006 ± 0.00003 Kinetic parameters for α- and β3-amino acid aminoacylation. Amino kcat Ratio KM Ratio kcat/KM Ratio acid (min−1) (α/β) (μM) (α/β) (μM−1 · min−1) (α/β) α-Phe 0.86 ± 0.11 3.7 ± 0.7 200.4 ± 78.8 1.7 ± 0.9 0.0043 ± 0.001 2.2 ± 1.3 β-Phe 0.24 ± 0.03 119.1 ± 51.5 0.002 ± 0.0008 α-Gly 5.8 ± 0.5 1.9 ± 1.0 13.4 ± 4.7 1.2 ± 1.00 0.43 ± 0.15 1.5 ± 0.7 β-Gly 3.1 ± 0.1 11.1 ± 2.8 0.24 ± 0.07 α-Met 1.4 ± 0.1 6.8 ± 1.3 243.4 ± 55.7 0.40 ± 0.18 0.006 ± 0.001 17.0 ± 8.5 β-Met 0.21 ± 0.03 608.6 ± 243.4 0.0003 ± 0.0001 α-Glu 0.046 ± 0.004 61.2 ± 9.1 277.1 ± 101.5 0.94 ± 0.60 0.00016 ± 0.00006 82.78 ± 68.2 β-Glu 0.00075 ± 0.00009 374.8 ± 270.8 0.000002 ± 0.000001 α-Tyr 70.5 ± 7.7 56.3 ± 6.8 12.4 ± 4.8 0.036 ± 0.0.016 5.7 ± 2.3 1541.7 ± 724.3 β-Tyr 1.25 ± 0.7 339.5 ± 80.3 0.0037 ± 0.0008 Kinetic constants for deacylation. Amino acid krev(min−1) Ratio (α/β) α-Phe 0.15 ± 0.008 0.49 ± 0.05 β-Phe 0.32 ± 0.03 α-Gly 0.21 ± 0.08 0.3 ± 0.1 β-Gly 0.71 ± 0.09 α-Met 2.1 ± 1.7 0.52 ± 0.49 β-Met 4.0 ± 1.8 α-Glu 0.32 ± 0.14 0.73 ± 0.42 β-Glu 0.43 ± 0.15 α-Tyr 1.9 ± 1.3 1.01 ± 0.75 β-Tyr 1.9 ± 0.6 Summary of equilibrium dissociation constants (KD, nM) for complexes between EF-Tu · GTP and aminoacyl tRNAs. KDfor complex KDfor complex with indicated α- with indicated β5- side chain amino acid amino acid Phe 9.0 ± 3.0 24.0 ± 9.8 Met 6.2 ± 2.0 21.5 ± 11.2 Tyr 36.0 ± 11.0 29.1 ± 11.4 Glu 40.5 ± 14.3 29.9 ± 10.7 Gly 5.0 ± 2.3 5.4 ± 2.0 Example 2
Molecular Dynamic Simulations (MD) of TyrRS and PheRS
Materials and Methods
Results
Example 3
EF-Tu varies on 3- to 8-Fold with α-/β3-Amino Acid Identity
Materials and Methods
Results
Example 4
P7A7 Ribosomes Modulate Improved β3Amino Acid Incorporation in Nascent Peptide Chains
Materials and Methods
Equation 4:
[100−(DHFR (SEQ ID NO: 7) MHHHHHHENAMPWNLPADLAWVKRNTLNKPVIMGRHTWESIGRPL PGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYE QLLPKAQKLYLTHIDAEVEGDTHYPDYEPDDWERVFSEYHDADAQN SHSYCYEILERRGSRSHHHHHH Results
Spectral counting analysis of the extent of β3-(p-Br)Phe and α-Phe incorporation into DHFR by ribosomes The spectra for peptides containing β3-(p-Br)Phe includes both +91.9 and +93.9 isotopes of Bromine, with the +93.9 isotope included in the value listed for the calculated molecular weight (MWcalc) β3-(p- Br)Phe:α- Ribosome Peptide X MWcalc Spectra Phe 040329 VXSEYHDADAQNSHSYCYEILER α- 2832.208 271 1:34 (SEQ ID NO: 8) Phe VXSEYHDADAQNSHSYCYEILER β3- 2926.144 8 (SEQ ID NO: 9) Br- hPhe P7_A7 VXSEYHDADAQNSHSYCYEILER α- 2832.208 145 1:9 (SEQ ID NO: 8) Phe VXSEYHDADAQNSHSYCYEILER β3- 2926.144 16 (SEQ ID NO: 9) Br- hPhe P7A7 rRNA Sequence: (SEQ ID NO: 4) AGCGUUCUUUGAAGUGCUCACACAGAUUGUCUGAUGAAAAUGA GCAGUAAAACCUCUACAGGCUUGUAGCUCAGGUGGUUAGAGCG CACCCCUGAUAAGGGUGAGGUCGGUGGUUCAAGUCCACUCAGG CCUACCAAAUUUGCACGGCAAAUUUGAAGAGGUUUUAACUACA UGUUAUGGGGCUAUAGCUCAGCUGGGAGAGCGCCUGCUUUGCA CGCAGGAGGUCUGCGGUUCGAUCCCGCAUAGCUCCACCAUCUCU GUAGUGAUUAAAUAAAAAAUACUUCAGAGUGUACCUGCAAAGG UUCACUGCGAAGUUUUGCUCUUUAAAAAUCUGGAUCAAGCUGA AAAUUGAAACACUGAACAACGAAAGUUGUUCGUGAGUCUCUCA AAUUUUCGCAACACGAUGAUGAAUCGAAAGAAACAUCUUCGGG UUGUGAGGUUAAGCGACUAAGCGUACACGGUGGAUGCCCUGGC AGUCAGAGGCGAUGAAGGACGUGCUAAUCUGCGAUAAGCGUCG GUAAGGUGAUAUGAACCGUUAUAACCGGCGAUUUCCGAAUGGG GAAACCCAGUGUGUUUCGACACACUAUCAUUAACUGAAUCCAU AGGUUAAUGAGGCGAACCGGGGGAACUGAAACAUCUAAGUACC CCGAGGAAAAGAAAUCAACCGAGAUUCCCCCAGUAGCGGCGAG CGAACGGGGAGCAGCCCAGAGCCUGAAUCAGUGUGUGUGUUAG UGGAAGCGUCUGGAAAGGCGUGCGAUACAGGGUGACAGCCCCG UACACAAAAAUGCACAUGCUGUGAGCUCGAUGAGUAGGGCGGG ACACGUGGUAUCCUGUCUGAAUAUGGGGGGACCAUCCUCCAAG GCUAAAUACUCCUGACUGACCGAUAGUGAACCAGUACCGUGAG GGAAAGGCGAAAAGAACCCCGGCGAGGGGAGUGAAAAAGAACC UGAAACCGUGUACGUACAAGCAGUGGGAGCACGCUUAGGCGUG UGACUGCGUACCUUUUGUAUAAUGGGUCAGCGACUUAUAUUCU GUAGCAAGGUUAACCGAAUAGGGGAGCCGAAGGGAAACCGAGU CUUAACUGGGCGUUAAGUUGCAGGGUAUAGACCCGAAACCCGG UGAUCUAGCCAUGGGCAGGUUGAAGGUUGGGUAACACUAACUG GAGGACCGAACCGACUAAUGUUGAAAAAUUAGCGGAUGACUUG UGGCUGGGGGUGAAAGGCCAAUCAAACCGGGAGAUAGCUGGUU CUCCCCGAAAGCUAUUUAGGUAGCGCCUCGUGAAUUCAUCUCCG GGGGUAGAGCACUGUUUCGGCAAGGGGGUCAUCCCGACUUACC AACCCGAUGCAAACUGCGAAUACCGGAGAAUGUUAUCACGGGA GACACACGGCGGGUGCUAACGUCCGUCGUGAAGAGGGAAACAA CCCAGACCGCCAGCUAAGGUCCCAAAGUCAUGGUUAAGUGGGA AACGAUGUGGGAAGGCCCAGACAGCCAGGAUGUUGGCUUUGAA GCAGCCAUCAUUUAAAGAAAGCGUAAUAGCUCACUGGUCGAGU CGGCCUGCGCGGAAGAUGUAACGGGGCUAAACCAUGCACCGAA GCUGCGGCAGCGACACUAUGUGUUGUUGGGUAGGGGAGCGUUC UGUAAGCCUGUGAAGGUGUGCUGUGAGGCAUGCUGGAGGUAUC AGAAGUGCGAAUGCUGACAUAAGUAACGAUAAAGCGGGUGAAA AGCCCGCUCGCCGGAAGACCAAGGGUUCCUGUCCAACGUUAAUC GGGGCAGGGUGAGUCGACCCCUAAGGCGAGGCCGAAAGGCGUA GUCGAUGGGAAACAGGUUAAUAUUCCUGUACUUGGUGUUACUG CGAAGGGGGGACGGAGAAGGCUAUGUUGGCCGGGCGACGGUUG UCCCGGUUUAAGCGUGUAGGCUGGUUUUCCAGGCAAAUCCGGA AAAUCAAGGCUGAGGCGUGAUGACGAGGCACUACGGUGCUGAA GCAACAAAUGCCCUGCUUCCAGGAAAAGCCUCUAAGCAUCAGG UAACAUCAAAUCGUACCCCAAACCGACACAGGUGGUCAGGUAG AGAAUACCAAGGCGCUUGAGAGAACUCGGGUGAAGGAACUAGG CAAAAUGGUGCCGUAACUUCGGGAGAAGGCACGCUGAUAUGUA GGUGAAGCGACUUGCUCGUGGAGCUGAAAUCAGUCGAAGAUAC CAGCUGGCUGCAACUGUUUAUUAAAAACACAGCACUGUGCAAA CACGAAAGUGGACGUAUACGGUGUGACGCCUGCCCGGUGCCGG AAGGUUAAUUGAUGGGGUUAGCCGCAAGGCGAAGCUCUUGAUC GAAGCCCCGGUAAACGGCGGCCGUAACUAUAACGGUCCUAAGG UAGCGAAAUUCCUUGUCGGGUAAGUUCCGACCUGCACGAAUGG CGUAAUGAUGGCCAGGCUGUCUCCACCCGAGACUCAGUGAAAU UGAACUCGCUGUGAAGAUGCAGUGUACCCGCGGCAAGACGAGC GUGACCCGUGAACCUUUACUAUAGCUUGACACUGAACAUUGAG CCUUGAUGUGUAGGAUAGGUGGGAGGCUUUGAAGUGUGGACGC CAGUCUGCAUGGAGCCGACCUUGAAAUACCACCCUUUAAUGUU UGAUGUUCUAACGUUGACCCGUAAUCCGGGUUGCGGACAGUGU CUGGUGGGUAGUUUGACUGGGGCGGUCUCCUCCUAAAGAGUAA CGGAGGAGCACGAAGGUUGGCUAAUCCUGGUCGGACAUCAGGA GGUUAGUGCAAUGGCAUAAGCCAGCUUGACUGCGAGCGUGACG GCGCGAGCAGGUGCGAAAGCAGGUCAUAGUGAUCCGGUGGUUC UGAAUGGAAGGGCCAUCGCUCAACGGAUAAAAGGUACUCCGGG GAUAACAGGCUGAUACCGCCCAAGAGUUCAUAUCGACGGCGGU GUUUGGCACCUCUGACUUGGCUCAUCACAUCCUGGGGCUGAAG UAGGUCCCAAGGGUAUGGCUGUUCGCCAUUUAAAGUGGUACGC GAGCUGGGUUUAGAACGUCGUGAGACAGUUCGGUCCCUAUCUG CCGUGGGCGCUGGAGAACUGAGGGGGGCUGCUCCUAGUACGAG AGGACCGGAGUGGACGCAUCACUGGUGUUCGGGUUGUCAUGCC AAUGGCACUGCCCGGUAGCUAAAUGCGGAAGAGAUAAGUGCUG AAAGCAUCUAAGCACGAAACUUGCCCCGAGAUGAGUUCUCCCU GACUCCUUGAGAGUCCUGAAGGAACGUUGAAGACGACGACGUU GAUAGGCCGGGUGUGUAAGCGCAGCGAUGCGUUGAGCUAACCG GUACUAAUGAACCGUGAGGCUUAACCUUACAACGCCGAAGGUG UUUUGGCGGAUUGAGAGAAGAUUUUCAGCCUGAUACAGAUUAA AUCAGAACGCAGAAGCGGUCUGAUAAAACAGAAUUUGCCUGGC GGCAGUAGCGCGGUGGUCCCACCUGACCCCAUGCCGAACUCAGA AGUGAAACGCCGUAGCGCCGAUGGUAGUGUGGGGUCUCCUCAU GCGAGAGUAGGGAACUGCCAGGCAUCAAAUAAAACGAAAGGCU CAGUCGGAAGACUGGGCCUUUCGUUUUAUCUGUUGUUUGUCGG UGAACGCUCUCCUGAGUAGGACAAAUCCGCCGGGAGCGGAUUU GAACGUUGCGAAGCAACGGCCCGGAGGGUGGCGGGCAGGACGC CCGCCAUAAACUGCCAGGCAUCAAAUUAAGCAGAAGGCCAUCCU GACGGAUGGCCUUUUUGCAUUGGCGCAGAAA
UGACUU at positions 2502-2507 in place of GAUGUC, and AGCGUGA from 2057-2063 relative to SEQ ID NO:1 are bolded and underlined.